KEGG   Castor canadensis (American beaver): 109688704Help
Entry
109688704         CDS       T04791                                 

Gene name
Dnase2b
Definition
(RefSeq) deoxyribonuclease-2-beta
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109688704 (Dnase2b)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     109688704 (Dnase2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II
Motif
Other DBs
NCBI-GeneID: 109688704
NCBI-ProteinID: XP_020022802
Position
Unknown
AA seq 357 aa AA seqDB search
MTARLPRTTLALLFLGLFGVLEAPTLSCRNEEGDAVDWFTFYKLPKRQDKEGRETGLEYL
YLDSTIRSWRRSEQLMNTSRSVLGRTLQQLYEAYASKGNDTAYLIYNDGVPKSVNYSRKY
GHTKGLLLWNRIQGFWLIHSIPGFPSVPEEGYDYPSTGRRNGQSGICITFKYNQYEAIDF
QLLVCNPNIYSCYIPATFHQELVHMPQLCARFNLPKIPGRHLTTLQSAQGQNFLHFAKSD
SFLDDIFAAWMAQQLKTHLLTETWQRKKQELPSNCSLPYHVYNIKAIKIAQQSYFSSYQD
HAKWCISQKGTKNRWTCIGDLNRSPHQASRSGGFICTQNWHIYQAFQRLVLYYEDCN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaagacttccaagaacaacccttgctttactctttcttggcctctttggggtc
ctagaggcaccaacactatcgtgcagaaatgaagaaggtgatgctgtggattggtttacc
ttttataagttacctaaaagacaagacaaggaaggtagagaaactgggctagagtacctc
tacctagactccacaattagaagctggaggaggagtgagcaactaatgaataccagcagg
agtgttctgggaaggaccttacaacagctttatgaagcttatgcctccaagggtaacgac
acagcttatctaatatacaatgatggagtccctaaatctgtgaattacagcagaaagtat
ggacacaccaaaggtttgctgctgtggaacagaatccaggggttctggctgattcattcc
attcccgggtttccttcagttcccgaagaaggctatgattatccatctacagggagacga
aatggacaaagtgggatctgcataactttcaagtacaaccagtatgaagcgatagatttt
cagctcttggtctgcaacccaaacatctatagctgttatatcccggccacctttcaccag
gaacttgtccacatgccccagctgtgtgccaggttcaacttaccaaagatccctggtcgg
cacctcaccacacttcagtcagcccagggacaaaacttcctccactttgcaaaatctgac
tcttttcttgatgacatctttgcagcatggatggctcaacaattgaagacacacttgcta
acagaaacttggcagcgaaagaaacaagagcttccttcaaactgctcccttccttaccat
gtctacaatatcaaagccataaagatagctcaacaatcttatttcagttcttaccaggac
catgctaaatggtgcatttcccaaaagggcaccaaaaatcgctggacatgtattggagac
ctaaatcggagcccacaccaagcctccagaagtggaggattcatttgtacccagaattgg
catatttaccaagcatttcaaagattagttttatattatgaggactgtaactag

DBGET integrated database retrieval system