KEGG   Castor canadensis (American beaver): 109689534Help
Entry
109689534         CDS       T04791                                 

Gene name
Ddc
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00350  Tyrosine metabolism
ccan00360  Phenylalanine metabolism
ccan00380  Tryptophan metabolism
ccan01100  Metabolic pathways
ccan04726  Serotonergic synapse
ccan04728  Dopaminergic synapse
ccan05030  Cocaine addiction
ccan05031  Amphetamine addiction
ccan05034  Alcoholism
Module
ccan_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109689534 (Ddc)
   00360 Phenylalanine metabolism
    109689534 (Ddc)
   00380 Tryptophan metabolism
    109689534 (Ddc)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    109689534 (Ddc)
   04726 Serotonergic synapse
    109689534 (Ddc)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    109689534 (Ddc)
   05031 Amphetamine addiction
    109689534 (Ddc)
   05034 Alcoholism
    109689534 (Ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109689534 (Ddc)
Enzymes [BR:ccan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109689534 (Ddc)
    4.1.1.105  L-tryptophan decarboxylase
     109689534 (Ddc)
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109689534 (Ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 109689534
NCBI-ProteinID: XP_020024017
Position
Unknown
AA seq 496 aa AA seqDB search
MFCQLASVLSVGSPVTMNASEFRRRGKEMVDYVANYLEGIEGRQVYPDVEPGYLRHLIPA
TAPQEPEKFEDIINDVERIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFS
WAASPACTELETVMMDWLGKMLELPEAFLAGKSGEGGGVIQGSASEATLVALLAARTKMI
QKLKTTSPELTQAAIMDKLVAYSSDQAHSSVERAGLIGGVRLKAIPSDGNFAMQASALQE
ALQRDKAAGLIPFFVVVTLGTTSCCSFDNLLEVGPICNKEDLWLHIDAAYAGSAFICPEF
RHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRIDLTGAFKLDPVYLKHNHQDSGLIT
DYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICAEV
TLGLVCFRLKGPNRLSKALLERINSVKKIHMVPCHLRDKFVLRFAICSRSVESTHVQLAW
EHIRELAGEVLSAEKE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttttgccaactggcttctgttctctctgtaggtagcccagtcaccatgaatgcaagt
gaattccggaggagagggaaggagatggtggattatgtggccaactacctggaaggcatc
gagggacgtcaggtctatcctgatgtggagcctggttacctacggcacttgattcctgcc
accgccccccaggaaccagaaaagtttgaggatatcatcaatgacgtagagaggataatc
atgccgggggtgacccactggcacagcccctatttctttgcctacttccccacggctagc
tcatacccggccatgcttgcagacatgctgtgcggagccattggttgcatcggattctcc
tgggctgcaagtccggcatgcacagagctggagacagtgatgatggactggcttgggaag
atgctggagctcccagaggcgtttttggctggaaaatctggggaaggaggaggagtgatc
cagggaagtgccagtgaagccactctggtggctctactggctgctcgaaccaaaatgatc
cagaagctgaagacaacttccccggagttgacgcaggctgccattatggacaagctggta
gcctactcatccgatcaggcacactcctctgtggaaagagctggattgattggcggagtg
agactaaaagcgattccttcggatggcaattttgccatgcaagcttctgccctgcaggag
gcgctgcagcgagacaaggcggccggcctgattcccttcttcgtggttgttacgctaggg
accacatcttgctgctcttttgacaatctcttagaagtgggtcctatctgcaacaaagag
gacctgtggctgcacattgatgctgcgtatgcaggaagtgcctttatctgcccagagttc
cggcatcttctgaatggagtggagtttgcagattcatttaactttaatccccacaaatgg
cttttggtgaattttgactgctccgccatgtgggtgaaaaagagaatcgacttaacagga
gccttcaaactggaccctgtttacctgaagcacaaccaccaggactcaggacttatcact
gactacaggcactggcagattccattgggccggaggttccgctcgttgaagatgtggttt
gtctttcgaatgtatggtgtcaaagggctgcaggcttacatccgcaagcacgtgcagctg
tctcatgagtttgagtctctggtgcgccaggatccccgctttgagatctgtgcggaagtc
actctggggctggtctgctttcggctaaagggtcccaaccgactgagcaaagcccttctg
gaaagaataaacagtgtcaagaaaatccacatggttccgtgtcacctccgagacaagttc
gtgctgcgttttgccatctgctctcgctctgtggaatctacccatgtgcagctcgcctgg
gagcacatccgagagttggctggtgaggtgctgagtgcagagaaggaatga

DBGET integrated database retrieval system