KEGG   Castor canadensis (American beaver): 109689942Help
Entry
109689942         CDS       T04791                                 

Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase-like
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00520  Amino sugar and nucleotide sugar metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    109689942
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     109689942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109689942
NCBI-ProteinID: XP_020024614
Position
Unknown
AA seq 390 aa AA seqDB search
MRAGQCAARAPVLQFTNCRILRGGALLREDLWVRAGRILDPEELFFEERRVADERRDCAG
RILAPGFIDVQINGGFGVDFSKATEDVGSGVALVAQRILSHGVTSFCPTLVTSPPEVYHK
VLPQIPVKSGGPHGAGVLGVHLEGPFISREKRGAHPEAHLRSFEANAFRDVLATYGPLDN
VRIVTLAPELGGSHEVIQALTAQGICVSVGHSVADLQAAEKAVQSGATFITHLFNAMLPF
HHRDPGIVGLLTSDQVPPGRCIFYGMIADGIHTNPAALRIAHRAHPQGLVLVTDAVPALG
LGNGRHTLGQQEVEVDGLTAYVAGTKTLSGSIAPMDVCVRHFLQATGQWVACTCVSGGRG
YVPESRRGGRNWESPCQYSSATGDRIQGMD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgggcagtgcgcggcgcgggctccggtgctccagttcaccaactgccgcatc
ctgcgcggcggcgcgctgctcagggaggacctgtgggtgcgcgcgggccgcatcttggac
cctgaggagctgttttttgaggagcggcgcgtggctgacgagcggcgggactgcgcgggc
cgcatcctggcgcccggcttcatcgacgtgcagatcaacggtggatttggtgttgacttc
tccaaggccacggaggacgtgggctcaggggtcgccctggtggcccagaggatcttgtcc
cacggtgtcacctccttctgccccactctggtcacttccccaccagaggtttaccacaag
gtccttcctcagattcccgtgaagagtggaggtccccatggggcaggggtcctcggggtg
cacctggagggtccgttcatcagccgggagaagcggggtgcacaccctgaggcccacctc
cgctcctttgaagccaatgctttccgtgacgtgctggccacctatggccccctggacaat
gtccgcatcgtgacgctggcccctgagctgggcggcagccatgaagtgatccaggcactg
acagcccagggcatctgcgtgtccgtagggcactccgtggctgacctgcaggctgcagag
aaagcagtgcagagtggggccacattcatcactcacctcttcaacgccatgttgcctttc
caccaccgtgatccaggcattgtggggctcctgaccagtgaccaagtgcccccgggccgc
tgcatcttctatgggatgatcgctgatggtatacacaccaatcctgcagccctgcgcatt
gcccaccgggcccatccccaggggctggtgctggtcactgatgctgtccctgccctgggc
ctaggcaatggccgccacacactagggcagcaggaggtagaggtagatgggctgacagcc
tatgtggcaggcaccaagacgctgagcggcagcattgcccccatggatgtctgcgtccgg
catttcctgcaggccacaggtcagtgggtggcgtgcacgtgtgtgtctgggggcagaggc
tacgtcccggagagccggaggggaggcaggaattgggagagtccgtgccaatattcttct
gccactggggacaggatccaggggatggactag

DBGET integrated database retrieval system