KEGG   Castor canadensis (American beaver): 109689990Help
Entry
109689990         CDS       T04791                                 

Gene name
Rock1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04022  cGMP-PKG signaling pathway
ccan04024  cAMP signaling pathway
ccan04062  Chemokine signaling pathway
ccan04071  Sphingolipid signaling pathway
ccan04270  Vascular smooth muscle contraction
ccan04350  TGF-beta signaling pathway
ccan04360  Axon guidance
ccan04510  Focal adhesion
ccan04530  Tight junction
ccan04611  Platelet activation
ccan04670  Leukocyte transendothelial migration
ccan04810  Regulation of actin cytoskeleton
ccan04921  Oxytocin signaling pathway
ccan05132  Salmonella infection
ccan05135  Yersinia infection
ccan05163  Human cytomegalovirus infection
ccan05200  Pathways in cancer
ccan05205  Proteoglycans in cancer
ccan05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109689990 (Rock1)
   04071 Sphingolipid signaling pathway
    109689990 (Rock1)
   04024 cAMP signaling pathway
    109689990 (Rock1)
   04022 cGMP-PKG signaling pathway
    109689990 (Rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109689990 (Rock1)
   04530 Tight junction
    109689990 (Rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109689990 (Rock1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109689990 (Rock1)
   04670 Leukocyte transendothelial migration
    109689990 (Rock1)
   04062 Chemokine signaling pathway
    109689990 (Rock1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109689990 (Rock1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109689990 (Rock1)
  09158 Development and regeneration
   04360 Axon guidance
    109689990 (Rock1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109689990 (Rock1)
   05206 MicroRNAs in cancer
    109689990 (Rock1)
   05205 Proteoglycans in cancer
    109689990 (Rock1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109689990 (Rock1)
   05135 Yersinia infection
    109689990 (Rock1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109689990 (Rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109689990 (Rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109689990 (Rock1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109689990 (Rock1)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   109689990 (Rock1)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109689990 (Rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 Cortex-I_coil HR1 APH Pkinase_C DUF1192
Motif
Other DBs
NCBI-GeneID: 109689990
NCBI-ProteinID: XP_020024668
Position
Unknown
AA seq 1284 aa AA seqDB search
MKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAF
ANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIH
SMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQG
GDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAK
NLICAFLTDREVRLGRNGVDEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDD
LEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSASPNDNRTSSNVDKSLQESLQK
TIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKML
LQHKINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKLVQLQKQLEEA
NDLLRTESDTAVRLRKGHTEMSKSISQLESLNRELQERNRILENSKSQMDKDYYQLQAVL
EAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLNHSEKEKNNLE
IDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKLKEEREAREKA
ENRVVQIEKQCSMLDVDLKQSQQKLEHLIENKERIEDEVKNLTLQLEQESNKRLLLQNEL
KTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELGQLTKQYRGNEGQMRELQDQLEAEQ
YFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLSTQLDLAETKAESEQLARGLLE
EQYFELTQESKKAASRNRQEITDKDNTVSRLEEMNSMLTKDIELLKKENEELTEKMRKAE
EEYKSKKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRKKANTQDLRKK
EKENRKLQLELNQEREKFNQMVVKHQKELNEMQAQLVEECTHRNELQMQLASKESDIEQL
RAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKI
LFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDV
EMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALECRRCHVKCHR
DHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPPSGFVRASPR
TLSTRSTANQSFRKVVKNTSGKTS
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgaagattatgaagtagtaaaggtgattggtagaggtgcatttggagaagtt
caattggtaaggcataaatccaccaggaaagtatatgctatgaagcttctcagcaaattt
gaaatgattaagagatctgattctgcttttttctgggaagaaagggacataatggctttt
gctaacagtccttgggttgttcagcttttttatgcattccaagatgatcgatatctctat
atggtgatggaatacatgcctggtggagaccttgtaaacttaatgagcaactatgatgtg
cctgaaaaatgggcacgattctatactgcagaagtagttcttgcattggatgcaatccat
tccatgggctttattcatagagatgtgaagcctgataacatgctgctggataaatctgga
catttgaagttagcagattttggtacttgtatgaagatgaataaggaaggtatggtacga
tgtgatacagcagttggaacacctgattatatttctcccgaagtactaaaatcccaaggt
ggcgatggttattatggtcgagaatgtgactggtggtcagttggggtatttttatatgaa
atgcttgtaggtgatacacctttttatgcagattctcttgttgggacttacagtaagatt
atgaaccataaaaattcacttacttttcctgatgataatgacatatcaaaagaagcaaaa
aatcttatttgtgccttcctcactgacagagaagtgagattaggaagaaatggtgtagat
gaaatcaaacgacatctcttcttcaaaaacgatcagtgggcttgggaaacactccgagac
actgtagcaccagttgtacctgatttaagtagtgacattgatactagtaattttgatgac
ttagaagaagataaaggagatgaagaaacatttcctattcctaaagcttttgttggcaac
caacttccttttgtgggatttacatattatagtaatcgcagatacttatcttcagcaagt
cccaatgacaacagaactagctccaatgtggataaaagcttgcaggaaagtttgcaaaaa
acaatctacaagcttgaagaacagctgcataatgaaatgcaattaaaagatgaaatggag
cagaagtgcagaacttcaaacataaaactagacaagataatgaaagaattggatgaagag
ggaaatcagagaagaaatctagaatccacagtgtctcaaattgagaaggagaaaatgttg
ctacaacataaaattaacgagtaccaaagaaaagctgaacaggaaaatgagaagagaaga
aatgtagaaaatgaagtttctacattaaaggatcagttggaagacttaaagaaagtaagt
cagaattcacagcttgctaatgagaagctggtgcaattacaaaagcagctagaagaagcc
aatgacttgcttaggacagaatcagacacagctgtaagattaaggaagggtcatacagag
atgagcaaatcaattagtcagctagagtccctgaacagagaattgcaggaaagaaacaga
attttagagaattccaagtcacaaatggacaaggattattaccagctgcaagctgtattg
gaagctgaacgaagagacagaggtcatgattctgagatgattggagaccttcaagctcga
attacatctttacaagaggaagtgaagcatctcaagcataatcttgaaagagtggaagga
gaaagaaaagaagcccaagacatgcttaatcattcagaaaaggaaaagaataatttagag
atagatttaaactacaagcttaaatcattacaacaacgtttagaacaagaggtaaatgaa
cacaaagtaaccaaagctcgtttaactgacaaacatcaatctattgaagaagcaaagtct
gttgccatgtgtgagatggaaaaaaagctgaaggaagagagagaagctcgagagaaggct
gaaaatagagttgttcagattgagaaacaatgttccatgctagatgttgatctgaaacaa
tctcagcagaagctagagcatttgattgaaaataaagaaaggatagaggatgaagtgaag
aatctaaccctgcagctggagcaggagtcaaataagcgactgttgttacaaaatgaatta
aagactcaagcatttgaggcagacaacttaaaaggtttagaaaagcagatgaaacaggaa
ataaatactttattggaagcaaagagattattagaatttgagttaggtcagcttacaaaa
cagtatagaggaaatgaaggacagatgcgggagctacaagatcaacttgaagctgagcag
tatttctcaacactttataaaacccaggtaaaggaacttaaagaagaaattgaagaaaaa
aacagagaaaatttaaagaagatacaggagctacaaaatgaaaaagaaacactttctact
cagttggatctagcagaaacaaaagccgagtctgaacagttggctcgagggcttctggaa
gaacagtattttgaattgacccaagaaagcaagaaagctgcttcaagaaatagacaagag
attacagataaagataatactgttagtcggcttgaagaaatgaacagcatgctaaccaaa
gatattgagttactcaaaaaagaaaatgaagagctaaccgaaaaaatgaggaaggcagaa
gaagaatataagtcaaagaaggaggaggagatcagtaatcttaaggctgcatttgaaaag
aatatcaatacagaacgaacccttaaaacacaggctgttaacaagttggcagaaataatg
aatcgcaaagattttaaaattgatagaaagaaagctaatacacaagatttgagaaagaaa
gaaaaagaaaatcgaaagttacaactggaactcaaccaagaaagagagaaattcaaccag
atggtagtgaaacatcagaaggagctgaatgagatgcaagcgcaattggtagaagaatgt
acacataggaatgagcttcagatgcagttggctagcaaagagagtgatattgaacagttg
cgtgctaagcttctggacctttcagattctactagtgttgctagttttcctagtgctgat
gaaactgatggaaaccttccagagtcaagaattgaaggctggctttctgtaccaaataga
ggaaatatcaaaagatatggctggaagaaacagtatgttgtggtaagcagcaaaaaaatt
ttgttctataatgatgaacaagataaggaacaatccaatccatctatggtattggacata
gataaattgtttcatgttcgacctgtcacgcaaggagatgtatacagagctgaaactgaa
gaaattcctaaaatattccagatactatatgcaaatgaaggagaatgtagaaaagatgta
gaaatggaaccagtacaacaagctgaaaaaactaatttccaaaatcacaaaggccatgag
ttcatccctacactctaccacttccctgccaactgtgaggcctgtgccaaacctctctgg
catgtttttaagccaccccctgccctagagtgtcgaagatgccatgttaagtgccacaga
gatcacttagataaaaaggaggacttaatttctccatgtaaagtaagttatgatgtaacg
tcagcaagagatatgctgctgttagcatgttctcaggatgaacagaaaaaatgggtaact
catttagtaaagaagatccctaaaaatccaccatctggttttgttcgtgcctcgcctcgg
acgctttctacaagatccactgcaaatcagtctttccggaaagtggtcaaaaatacatct
ggaaaaactagttaa

DBGET integrated database retrieval system