KEGG   Castor canadensis (American beaver): 109690085Help
Entry
109690085         CDS       T04791                                 

Gene name
Sephs1
Definition
(RefSeq) selenide, water dikinase 1
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00450  Selenocompound metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109690085 (Sephs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccan03016]
    109690085 (Sephs1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     109690085 (Sephs1)
Transfer RNA biogenesis [BR:ccan03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    109690085 (Sephs1)
 Prokaryotic Type
    109690085 (Sephs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 109690085
NCBI-ProteinID: XP_020024817
UniProt: A0A250YH48
Position
Unknown
AA seq 392 aa AA seqDB search
MSTRESFNPESYELDKSFRLTRFTELKGTGCKVPQDVLQKLLESLQENHFQEDEQFLGAV
MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
NMLMLLGVSNKMTDRERDKVIPLIIQGFKDAAEEAGTSVTGGQTVLNPWIVLGGVATTVC
QPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
MVNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQVATQNVNPTPGATS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgcgggagtcctttaacccggaaagttatgaattggacaagagcttccggcta
acgagatttactgaactgaagggcacaggctgcaaagtgccccaagatgtcctgcagaag
ttgctggagtctttgcaagaaaaccacttccaagaagatgagcagtttctgggagccgtc
atgccaaggctgggcattggaatggatacttgcgtcatacctttgaggcatggtggtctt
tccttggttcaaaccacggattacatttatcccatcgtagacgacccttacatgatgggc
aggatagcatgtgccaatgtcctcagtgacctctatgccatgggggtcacagagtgtgac
aatatgttgatgctccttggagtcagtaataaaatgacggacagggaaagggataaagtg
atacccctaattatacagggttttaaagatgcagcagaggaagcggggacctctgtgaca
ggtggccagacagtgttaaacccctggattgtcctgggaggagtcgcaacaactgtctgc
cagcccaatgagtttatcatgccagacaatgcagtaccaggggacgtgctagtgttgaca
aaacccctggggacacaagtcgccgttgctgtgcaccagtggctggatattcctgaaaaa
tggaataaaattaagctggtggtaacccaggaagacgtggagctagcataccaagaggca
atggtgaacatggcgcggctcaacaggacagctgcaggacttatgcacacattcaatgcc
catgcagccaccgacatcacaggcttcgggattttgggccatgcacagaacctggccaag
cagcagaggaatgaggtgtcgtttgtgattcacaaccttcctgtgctggccaagatggct
gccgtgagcaaggcttgtggaaacatgtttggcctcatgcatgggacctgcccggagacg
tcaggaggccttctgatctgtttaccacgtgaacaagcagctcggttctgtgcagagata
aagtccccgaaatacggcgaaggccaccaagcatggattattgggattgtagagaagggc
aaccgcacggccagaatcatagataagccccggatcattgaagttgcaccacaagtggcc
acacaaaacgtgaaccccacacctggcgccacctcttaa

DBGET integrated database retrieval system