KEGG   Castor canadensis (American beaver): 109691139
Entry
109691139         CDS       T04791                                 

Gene name
Akap5
Definition
(RefSeq) LOW QUALITY PROTEIN: A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccan01009]
    109691139 (Akap5)
Protein phosphatases and associated proteins [BR:ccan01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     109691139 (Akap5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 109691139
NCBI-ProteinID: XP_020026522
Position
Unknown
AA seq 419 aa
METTVSEIQVENKDEKREVCPKVERQEGKTSMLCFKRRKKSAKALKPQAGSEAADARKCH
PEAGTSDQPQHPEGTWASIKRLVTRRKRSESSKQQKSFEAEVQPEIKPKDADVSKKKAKS
KLKIPCLKFPRGVQRSNRSKIIEDSDCSIKVQGEVEGLDIQTQTQLNDQATKAESTQDLS
EGVSRKDDEVCESNVSNSIASGEEVISVELGLDNRHSAIHTETVILEEIDMIEEKPSVQQ
PQQASPLGSSETDSQHPVASDVPPSPAVPDEQIVEEMSNKILESEPNWKDDESREIPAEE
DKPKDIELSQEDFKENATNSEKPKWEESKRMEPIAIIITDTEISEFDATKAKNVPKQFLI
SNESEQVGFFANDSDFEGRTSEQYETLLIETASSLVKNAIQLSIKQLVNEMASDDNKIQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagtagaaaataaggatgagaaaagagaagtttgt
cccaaggttgagaggcaggagggaaaaacatccatgctttgcttcaagagaagaaagaaa
tcagccaaggcgctgaagccccaagctggctctgaggctgctgatgcaaggaagtgtcat
ccagaagcaggaacttctgatcagccacagcacccagaggggacctgggcctcaatcaaa
cgtcttgtaacacgcaggaaaaggtcagagtcttccaagcagcaaaagtcatttgaggct
gaagtacaacctgaaataaagcccaaagatgctgacgtttctaagaaaaaggcaaaatcc
aaacttaagattccctgcttaaaattcccaagaggggtacaaaggagtaatcgttccaaa
attatagaagactcagactgcagcatcaaagtccagggagaggttgaaggtttggatata
caaactcagacccagttaaatgaccaggcaacaaaggctgagtcaacccaggacctaagt
gaaggtgtctcacggaaagatgatgaggtctgtgagtcaaatgtgagcaacagcatagca
tctggagaggaggtgatctccgtggaacttgggttagataacaggcattctgctattcac
acagaaactgtaatccttgaagaaattgatatgattgaggaaaagccaagcgttcaacaa
ccccagcaagcaagcccactgggcagttcagaaacagacagtcagcatccagtggcttct
gatgttcctccctcacctgcagtgccagatgaacaaattgtggaagaaatgagcaacaag
atcctagaaagtgagccaaactggaaagacgatgaaagtagagagattccagctgaagag
gataagccaaaagacattgaactaagtcaagaagattttaaagaaaatgcgaccaattca
gagaaacccaagtgggaagaaagcaaaagaatggagcccattgctatcattattacagac
actgaaatcagtgaatttgatgctacaaaagctaaaaatgttcctaagcaattcttaatc
tcaaatgaaagtgagcaagtagggttttttgctaatgatagtgattttgaaggtagaact
tcagaacaatatgaaacactcttaatagaaacagcttcttcccttgtcaagaatgctatc
cagttgtctataaaacagctggttaatgaaatggcctctgatgataataaaatacagtga

DBGET integrated database retrieval system