KEGG   Castor canadensis (American beaver): 109691564Help
Entry
109691564         CDS       T04791                                 

Gene name
Bst1
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00760  Nicotinate and nicotinamide metabolism
ccan01100  Metabolic pathways
ccan04970  Salivary secretion
ccan04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    109691564 (Bst1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    109691564 (Bst1)
   04972 Pancreatic secretion
    109691564 (Bst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccan04090]
    109691564 (Bst1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccan00537]
    109691564 (Bst1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     109691564 (Bst1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     109691564 (Bst1)
CD molecules [BR:ccan04090]
 Proteins
  109691564 (Bst1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ccan00537]
 Enzymes
  109691564 (Bst1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 109691564
NCBI-ProteinID: XP_020027234
Position
Unknown
AA seq 391 aa AA seqDB search
MGSTSVAGLCHEQSSYPRSGLKLSIGTKRGTESKQVCCRGKSGAHLSPGKPSSWWERKWE
ESKRLLAGEANVSWMAARGRTPWPRPGLPLLRLLLAAGAAGAAGARWSGEGSSPHLQSIF
LGRCAEYSALLSAHSGDKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHSIPRDKSL
FWENNHLLVTSYSENSRHLMPLCDVLYGRVGDFLSWCRQKNTSELDYQSCPTSEDCENNP
VDSFWRRASIQYSRDSSGVIYVMLNGSEPTGAYPVKGFFADFEIPYLQKDKITRIEIWVM
HEIGGPNVESCGEGSVKILEDRLKSMGFQYSCINDHLPVKLLKCVDHSTHPDCALNSAAA
SIQGEIPSVRTEQSASLIIPLLVALASGSQM
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggggtccaccagtgtagcaggactctgccacgagcaatcgtcctatcccaggagcggt
ctcaagctcagtattggaactaaaagggggacagaaagcaagcaggtgtgctgtcggggc
aagagtggtgcccatctcagccccgggaaaccgtcttcctggtgggagaggaagtgggag
gagtccaagaggctcctggctggagaagccaatgtctcctggatggcggctcggggacgc
acgccttggccgcggcctgggctcccgctgctgcggctgctgctggcggcgggcgcggcg
ggcgcggcgggcgcgcgctggagcggggagggcagcagcccgcacctgcagagcatcttc
ctgggccgctgtgccgagtacagcgcgctactgagcgcccacagcggggacaagaactgc
acagccatctgggaagcctttaaggtggtgctggacaaggatccttgctctgtgcttccc
tcggactatgacctttttattaacctctccaggcactccattcccagagacaagtccctg
ttctgggaaaataaccaccttcttgtcactagctattcagagaattcccgtcaccttatg
cccctgtgtgacgttctgtatggcagggttggagatttcttgagttggtgccgacagaaa
aacacctctgaacttgattaccaatcctgccctacatcagaagactgtgaaaacaatcct
gtggattccttctggagaagagcatccattcagtattcaagagatagttctggggtgatt
tatgtcatgctgaatggttctgaaccaacaggagcctatcccgtcaaaggattttttgca
gactttgaaattccatacttgcagaaggacaaaattacacgaattgaaatctgggtcatg
catgaaatcgggggacctaatgtggaatcctgtggggagggcagtgtgaaaatcctggaa
gacagactgaagtctatggggttccagtacagctgtattaatgatcacctaccagtgaag
cttttaaagtgcgtggaccacagcactcaccctgactgtgccttaaattcggcggcagca
tctattcaaggagagatcccatctgtccgtacagagcagagtgccagccttatcattcct
ctcttagtggctttggcttcaggttctcaaatgtaa

DBGET integrated database retrieval system