KEGG   Castor canadensis (American beaver): 109691739Help
Entry
109691739         CDS       T04791                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00120  Primary bile acid biosynthesis
ccan01100  Metabolic pathways
ccan03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    109691739
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    109691739
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ccan00199]
    109691739
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     109691739
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     109691739
Cytochrome P450 [BR:ccan00199]
 Cytochrome P450, animal type
  CYP8 family
   109691739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 109691739
NCBI-ProteinID: XP_020027494
Position
Unknown
AA seq 479 aa AA seqDB search
MPVSSRAAPTTQAPGTPFGQGPVPLLGHAMAFRKNAFEFLKGMWTKHGDVFTVQLGGQYF
TFIMDPLSFGPIIKESQKKLDFVKYSQQLVLKVFGYQSVEGDIQMIHLASTKYLMGAGLE
VLNTAMLDSLSLVMLGPKGWSPDASCWHEDGLFHFCYNILFKAGYLSLFGYTKDKEQDLL
RAEEIFVKFRRFDLLFPRFVYNLLGPREWLEVAQLQHLFHKTLSVKHSLERDSMSTWLCY
MLRRLREQGIAPAMQDKFIFMMLWASQGNTGPTSFWALLFLMKHPEAMQAVREEAIQVLG
EARLEPKKFFSFKFSALKHTPVLDSVMEETLRLKAAPTLFRVVESDYTLKMASGQEYLLR
RGDKVALFPYLSVHMDPEIHPEPTTFKYDRFLNSNGSRKVDFYKAGKKIHHYIMPWGSGV
SICPGRFFALSEIKLFVLLMVTYFDLVLVDPDIPVPPCDQTGGALASHSPAMRCASATA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgtcttccagggctgctccgacaacgcaagccccaggaaccccctttggacaa
gggcctgtgcccttgctcggccatgccatggctttccggaagaatgcgtttgaattcttg
aaaggaatgtggactaagcatggggatgtgttcacagtgcagctagggggccaatacttc
acctttatcatggaccccctgtcctttggccctatcatcaaggaatcacagaagaaacta
gactttgtgaagtactcacaacaactggtgctaaaggtatttggatatcagtcggtggag
ggggacattcagatgatacacttagccagtaccaagtatctgatgggcgctggcttggag
gttctcaatacagccatgctggacagcctgtccttggtgatgctgggacccaaaggctgg
agtccagacgccagttgctggcatgaggatggcctctttcacttctgctacaacatcttg
ttcaaggctggctacctgagcttgtttggctacacaaaggacaaggaacaggacctgcta
cgggcagaggagatattcgtgaagttccgcagattcgatctcctttttcccaggtttgtc
tacaatttactggggccccgggagtggctagaagtggctcaactccagcatctctttcac
aagacactgtctgtgaaacacagcctggagagggatagcatgagcacctggttatgctac
atgcttcggcgtctgagggagcagggaatagctccagctatgcaggacaaattcatcttc
atgatgctgtgggcctcccaggggaacacagggcccacttccttctgggccctcttattc
ctcatgaaacacccagaagccatgcaagctgtgagggaggaggccatccaggtcctgggt
gaggccaggctggaacccaagaagttcttctccttcaaattcagtgccctgaaacacacc
ccagtcctggacagtgtgatggaagaaaccctgcgtctgaaggctgcacccaccctcttt
agggtggtggagagtgattataccctgaagatggccagtgggcaggagtacctgttacgc
cgtggagataaagtagccctttttccctacctctcagtgcacatggaccctgaaatccac
cctgagcctacaaccttcaagtatgatcgattcctcaactccaatggcagccgaaaagtg
gatttctataaagcaggcaagaagatccaccactacatcatgccttggggctcaggtgtc
tccatctgccctggcaggttctttgccctcagtgagataaagctctttgtattgctcatg
gtcacatactttgacctggtgctggtagaccctgatatacctgtgcccccttgtgaccag
accggtggggctttggcatctcacagcccagctatgaggtgtgcttccgctaccgcctga

DBGET integrated database retrieval system