KEGG   Castor canadensis (American beaver): 109693462
Entry
109693462         CDS       T04791                                 

Gene name
Ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccan03000]
    109693462 (Ahrr)
Transcription factors [BR:ccan03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109693462 (Ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3
Other DBs
NCBI-GeneID: 109693462
NCBI-ProteinID: XP_020030382
Position
Unknown
AA seq 707 aa
MIPPGECTYAGRKRRKPVQKRRPAMGTEKSNPSKRHRDRLNAELDHLASLLPFPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQEMRVQPAGALSPGDSPPGESLVQEGRLLLESLNGFA
LVVSAEGLIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPRMVCG
QPPHTETDDTVLGRLLRAQEGGTGSPSVYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKL
KFLFGQKKKAPSGTALPPQLSLFCTVVPIILPSVAEMKMKSVFLRAKHRADIAVTSDPRA
KSTMSLCGSELHRKPNYLAGRSNGENGISVFRAPTDGGHWTRVLARAPCLCFRGSPDPIL
DSEGATGDREEEEQERMLSDSARVRRQREMHRYNCHSETSAPERHLNWMTEQRGQEGSTK
LRLQPSKGEPFPVRAMPHGSCMPYPGAQGTFSANGLATFRDLPDHPPSAYCSRMGRTFRD
VYQGQVHPPTCHVSQGSLGTRLPPSGVQRFMAGGFSTEDAKLPSLPVPSDPPCNPALSLE
VQIKMENDSGSQDTVDGRLPGRVWLGASDVAKGHLVTFPAKVNLKTEPDYTHQVCTQHSG
HGMLGAHPHSRPTTGPCSELAPVYPAHCACMEPVPPHHLCTQSGRENQQPPLGCDCRAPG
AAPVVKCEPIDSLPWAAPGQGAVPGMFPKSASMTLIPPRASEAAFLP
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgattcctccgggggagtgcacatacgccggcaggaagaggaggaagcccgttcagaag
cggagacctgccatgggtactgagaagtcaaacccttctaagcgacatcgagatcgcctc
aatgcagagctggaccacctggccagcctgctgcccttcccacctgacatcatctccaag
ttggacaaactttctgtcctacgcctcagcgtcagttacctcagggtgaagagcttcttc
caagccttgcaggagatgcgtgtgcagccagcgggggccctctcacctggagacagccca
cctggagagtccctcgtgcaggagggacggctcctgctagagtctctcaatggctttgct
ctggtggtaagtgcagaagggttgattttttatgcatcggcaaccatcgtggactatctg
ggcttccaccagacagatgtaatgcatcaaaacatttatgactatatacatgtggatgac
cgccaggacttctgtcggcagctacactgggctatggacccgccgcggatggtgtgtggg
cagcccccacacacggagacagatgacactgtgctggggaggctgctgagggcccaggaa
gggggaacaggctcgccctcggtgtactctgccttcctgacgcgctgcttcatctgccgt
gtgcgttgcttgttggacagcacctctggctttctgaccatgcaattccaaggaaaacta
aaattcctgtttggacagaagaagaaggcgccatcaggaacagccctgccccctcagctc
tcactgttctgcactgtggtgccaatcatcctaccttctgtggcagagatgaaaatgaag
agtgtgttcttgagggcaaagcacagggcagacatcgcagtcacatcagacccaagggca
aaatctaccatgagtctgtgtggatcagaattgcaccgaaagcccaattacttagcaggg
aggagcaatggagaaaatggcatctcagtgttcagagcaccaacagatggtggccactgg
actcgggttctagccagggccccatgcctgtgcttcaggggcagccctgatcccatcctg
gactccgagggggccacaggggacagggaagaagaggagcaggagaggatgctgagtgac
tctgccagagtgaggaggcagagggagatgcacaggtacaactgccactcagagacatca
gcacctgaaaggcatctaaactggatgacagaacagcgaggccaagagggtagcaccaaa
ctgaggctgcaacccagtaagggcgagcccttccctgtgcgtgccatgccccatggctcc
tgcatgccctacccaggggcccagggcacattcagtgccaatggcctggctactttcaga
gatctgccagaccatccccccagtgcctactgcagccggatgggcagaacctttcgggac
gtctaccagggccaggtgcacccacccacttgccatgtctcccagggtagcctggggacc
cggctccccccatctggagtacagcgcttcatggctggaggcttctccacagaggacgca
aagttgcccagcctgccagtgccctccgatcccccatgcaatccagcactgtcgctggaa
gtacagatcaagatggaaaatgactctgggtcccaggacacagtagatggccgcctcccc
ggcagggtgtggttgggagctagcgatgtggccaagggacatctggtcacattccctgcc
aaagtgaacctgaaaaccgagccagactacacgcatcaggtctgcacccaacactccggg
catggcatgttgggggctcatccccacagcaggcccaccactggaccctgcagtgagttg
gccccagtctatcctgcacactgtgcctgtatggagccagtgcctccccaccacctctgc
acgcagagcggcagagagaaccagcaaccccctctgggatgtgactgcagagcacctggg
gctgcccctgtggtcaagtgtgagcccatagactcactcccatgggctgcccctggccag
ggggctgtgcctgggatgttccccaaaagtgcctccatgacgctgatcccgcccagagcc
tctgaggcagctttcctgccttag

DBGET integrated database retrieval system