KEGG   Castor canadensis (American beaver): 109694006Help
Entry
109694006         CDS       T04791                                 

Gene name
Insr
Definition
(RefSeq) LOW QUALITY PROTEIN: insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04022  cGMP-PKG signaling pathway
ccan04066  HIF-1 signaling pathway
ccan04068  FoxO signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04150  mTOR signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04152  AMPK signaling pathway
ccan04211  Longevity regulating pathway
ccan04213  Longevity regulating pathway - multiple species
ccan04520  Adherens junction
ccan04910  Insulin signaling pathway
ccan04913  Ovarian steroidogenesis
ccan04923  Regulation of lipolysis in adipocytes
ccan04930  Type II diabetes mellitus
ccan04931  Insulin resistance
ccan04932  Non-alcoholic fatty liver disease (NAFLD)
ccan04960  Aldosterone-regulated sodium reabsorption
Module
ccan_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109694006 (Insr)
   04015 Rap1 signaling pathway
    109694006 (Insr)
   04010 MAPK signaling pathway
    109694006 (Insr)
   04066 HIF-1 signaling pathway
    109694006 (Insr)
   04068 FoxO signaling pathway
    109694006 (Insr)
   04072 Phospholipase D signaling pathway
    109694006 (Insr)
   04022 cGMP - PKG signaling pathway
    109694006 (Insr)
   04151 PI3K-Akt signaling pathway
    109694006 (Insr)
   04152 AMPK signaling pathway
    109694006 (Insr)
   04150 mTOR signaling pathway
    109694006 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    109694006 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109694006 (Insr)
   04923 Regulation of lipolysis in adipocyte
    109694006 (Insr)
   04913 Ovarian Steroidogenesis
    109694006 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109694006 (Insr)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    109694006 (Insr)
   04213 Longevity regulating pathway - multiple species
    109694006 (Insr)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    109694006 (Insr)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109694006 (Insr)
   04931 Insulin resistance
    109694006 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109694006 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:ccan04090]
    109694006 (Insr)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109694006 (Insr)
Protein kinases [BR:ccan01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   109694006 (Insr)
CD molecules [BR:ccan04090]
 Proteins
  109694006 (Insr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476 APH
Motif
Other DBs
NCBI-GeneID: 109694006
NCBI-ProteinID: XP_020031236
Position
Unknown
AA seq 1368 aa AA seqDB search
MGAGGRRGAAAAALLVAVASLLVGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLRDLFPNLTVIRGSRLFFNYAL
VVFEMVHLKELGLYNLMNITRGAVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDKE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLVCTPCQGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EVGNYSFYALDNQNLRQLWDWSKHNLTIIQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTTFDKIMLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDVDPPQRSNDPKSQKHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQILLKWKPPSDPNGNITHYLVYWE
RQAEDSELFELDYCLKGLKLPSRTWFPPFESKDSQKHNQSDYEDSTGDAGNCQASESXQE
MEXSLFKKTFEDYLHNVVFVPRPSRKRRSLGDVVNVTMAVPTIPVFPNVSSTVVPTTPEE
HRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPEERCSVAAYVSARTMPEAKADDII
GPVTHEIFENNVVHLMWQEPQEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLR
GLPPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGS
IYIFLRKRQPDGPMGPLYASSNPEYLSASDVFPCSVYVPDEWEVPREKITLLRELGQGSF
GMVYEGNAKDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVS
KGQPTLVVMELMAQGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKK
FVHRDLAARNCMVAHDFTVKIGDFGMTRDIYEMDYYRKGGKGLLPVRWMAPESLKDGVFT
ASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMHMCWQ
FNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESDELEMEFEDMENVPLDRSSH
CQREEAGGREGGSSLGIKRNYEEHIPYTHMNGGKKNGRILTLPRSNPS
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgggggtcggcggggggcggctgccgcggcgctgctggtggcggtggcctcg
ctcctggtgggcgccgcgggccacctgtaccctggagaggtgtgtcctggcatggacatt
cggaacaacctcaccaggctgcatgaactggagaactgctcggtgatcgagggacacctg
cagatcctgctgatgttcaagacgagacccgaggacttccgagacctcagcttccccaag
ctcatcatgatcactgactacctgctgctcttccgagtgtacgggctggagagcctgcgg
gacctgttccccaacctcacggttatccgcggctcccgcctcttcttcaactacgccctg
gtggtcttcgagatggttcacctgaaggagctggggctctacaacctgatgaacatcacc
cggggtgctgtccgcatcgagaagaacaatgagctgtgctacttggccaccatcgactgg
tctcgcatcctggactctgtggaggacaactatattgtcctgaacaaggacgacaaggag
gagtgtggagatgtctgtcctggcaccgccaagggcaagaccaactgccctgccactgtc
atcaatgggcagtttgtggagcgatgctggacccacagccattgccagaaagtttgcccc
accatctgcaagtcacacggctgcaccgctgaaggtctgtgctgccacagcgaatgccta
ggcaactgttctgagcctgatgaccccaccaagtgcgtggcctgccgaaacttctacctg
gacggcaggtgtgtggagacctgcccacccccctactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcacaacaagtgcaagaactccaggcgacagggc
tgccaccagtacgttattcacaacaacaagtgcatccctgagtgtccctctgggtacacg
atgaattccagcaatttggtctgcactccgtgtcaggggccctgccccaaggtctgtcac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggaactccgaggctgc
actgtggtcaatggcagccttatcatcaacatccgaggaggcaacaacctggctgctgag
ctagaagctaacctcggcctcattgaagaaatttcaggttatctaaaaatccgccgatcc
tatgcccttgtgtctctttcctttttccggaagctacgtctgattcgaggagagactttg
gaagtcgggaactactctttctatgccttggacaaccagaacctgaggcagctgtgggac
tggagcaagcacaacctcaccatcattcaggggaagctcttcttccactacaaccccaag
ctctgcctgtctgaaatccacaagatggaagaggtctcgggaaccaagggtcgccaggag
aggaatgacattgccctcaagaccaatggggaccaggcttcctgtgaaaatgaattactt
aaattttctttcatccggacaacttttgacaagatcatgctgaaatgggagccttactgg
ccccctgacttccgagacctcttggggttcatgcttttctataaggaggccccttatcag
aacgtgacagagtttgacgggcaggacgcatgtggctccaacagctggacagtagtggac
gttgacccgccccagagatccaatgacccaaagtcacagaaacaccccggctggctgatg
cgggggctcaagccttggacccagtacgccatctttgtgaagaccttggttaccttttct
gatgaacggcggacctatggggccaagagtgacatcatctatgtgcagactgatgccacg
aatccctccgtccccctggatcccatctcggtttctaattcctcatcccagattcttttg
aagtggaagcctccctctgaccccaatggcaatatcacgcactacctggtttactgggag
aggcaggcggaagacagtgagctcttcgagctggattattgcctcaaagggttgaagctg
ccctcccggacatggttcccaccatttgagtccaaagattcccagaaacacaatcagagt
gactacgaggactccactggggatgctggtaactgccaggcgtccgagtcctgacaggag
atggaanggagtctcttcaagaagacctttgaggactacctgcacaacgtggtttttgtc
cccaggccctccaggaaacgcaggtctcttggtgacgtggtaaatgtgacaatggctgtg
cccacgatcccggttttccccaatgtctcctccactgtggtgcccacaacccccgaggag
cacaggcccttcgagaaagtagtgaacaaggagtccctggtcatctcaggcctgcgccac
ttcactggctaccgcatcgagctgcaggcctgcaaccaagactctcctgaagagaggtgc
agcgtggctgcctatgtcagtgccaggaccatgcctgaagccaaggcagatgatatcatt
ggccctgtgacccatgaaatctttgagaacaatgttgttcacttgatgtggcaagagcct
caggagcccaacggtctcattgtgctatatgaagtgagttatcggcgatacggcgatgag
gaactccatctctgtgtctccaggaagcattttgccctggagcggggctgcaggctgcgc
gggctgccaccggggaactacagtgtccgagtccgggccacctccctggctggcaatggc
tcctggacggaacccacctatttctatgtgacagattacttggacgtcccatcaaatatt
gcaaaaattatcatcgggccccttatcttcgtctttctcttcagtgtcgtgattggaagt
atttacatattcctgagaaagaggcaaccagatgggccaatgggaccactgtatgcttcc
tcaaaccccgagtacctcagtgccagtgatgtgtttccgtgctctgtgtacgtgccggat
gagtgggaggtccctcgagagaagatcaccctcctgcgggagctgggccaaggttccttt
ggcatggtgtatgagggcaacgccaaggacatcgtcaagggcgaggcagagacccgtgtg
gcggtgaaaacagtcaatgagtcagccagtctccgggagcggatcgagttcctcaatgag
gcatcggtcatgaaaggcttcacctgccatcatgtggttcgtctcctgggggtggtgtcg
aagggccagccaacgctggtggtgatggagctgatggctcaaggggacctgaagagctac
cttcgttccttgaggcctgaggctgagaataatccgggtcgccctcccccaaccctgcaa
gagatgattcaaatggcagcagagatagccgatggcatggcctacctgaacgctaagaag
tttgtgcaccgggacctggcagctcgaaactgcatggtcgcccatgattttaccgtcaaa
attggagactttggaatgaccagagacatctatgaaatggattactaccggaaagggggc
aagggcctgctgcctgtacggtggatggcacccgagtccctgaaggatggggtctttacc
gcatcttctgatatgtggtccttcggtgttgtcctttgggaaatcaccagcttagcagaa
cagccttaccaaggcctgtctaatgaacaggtgctgaaatttgtcatggatggagggtat
ctggatcagcccgacaattgtccagagagagtcaccgacttgatgcacatgtgttggcag
ttcaaccccaagatgcggccgaccttcctggagattgtcaacctgctcaaagatgaccta
catcccagctttccagaagtttccttcttccacagcgaggagaacaaggctcccgagagc
gatgagctggagatggagtttgaggacatggagaacgtcccattggatcgatcctcacac
tgtcagagggaggaggctgggggtcgggagggagggtcctctctgggcatcaagaggaac
tatgaagagcacatcccctacactcacatgaatgggggcaagaaaaacgggcggattctg
accctgcctcgctccaatccttcctaa

DBGET integrated database retrieval system