KEGG   Castor canadensis (American beaver): 109694543Help
Entry
109694543         CDS       T04791                                 

Gene name
B4galt4
Definition
(RefSeq) beta-1,4-galactosyltransferase 4
  KO
K07969  beta-1,4-galactosyltransferase 4 [EC:2.4.1.90 2.4.1.275 2.4.1.-]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00533  Glycosaminoglycan biosynthesis - keratan sulfate
ccan00601  Glycosphingolipid biosynthesis - lacto and neolacto series
ccan01100  Metabolic pathways
Module
ccan_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    109694543 (B4galt4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    109694543 (B4galt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccan01003]
    109694543 (B4galt4)
Enzymes [BR:ccan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.90  N-acetyllactosamine synthase
     109694543 (B4galt4)
    2.4.1.275  neolactotriaosylceramide beta-1,4-galactosyltransferase
     109694543 (B4galt4)
    2.4.1.-  
     109694543 (B4galt4)
Glycosyltransferases [BR:ccan01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   109694543 (B4galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 109694543
NCBI-ProteinID: XP_020032134
Position
Unknown
AA seq 344 aa AA seqDB search
MGCNLPFHLSYKVRLLLLFTLCLTVVGWATSNYFVGAIQEIPRAKAFIANFNKAITLGKE
DTLTNGASVKKAELENCPPVSPNLRGQSKLIFKPDLTLEEVQANNPKVTRGRYHPEECKA
SQRVAILIPHRNREKHLMYLLEHLHPFLQRQQLDYGIYIIHQAGSKKFNRARLLNVGYIE
ALKDEVWDCFIFHDVDLVPENDFNLYTCEDQPKHLVVGRNSTGYRLRYSGYFGGVTALSR
EQFFKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPEVGKYTMIFHTRDQGNEVNVG
RMKLLHQVSRVWKTDGLSSCSYKLLSVEYNPLYINITVDFWAGV
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaacctacctttccacctttcctacaaagtccgattgctattgctttttacc
ctgtgcctgacagtggtggggtgggccaccagtaactactttgtgggtgctattcaagag
attcccagagcaaaagctttcattgctaatttcaataaggccataactttgggaaaggaa
gacactctgaccaatggagcatctgtgaaaaaagcggaactggaaaactgccctcccgtg
tctccgaacctcagaggccagagcaagctcattttcaaaccagacctcactttggaggaa
gtacaggcaaataatcccaaggtgacccgaggccggtaccaccctgaggaatgtaaggct
tcacagcgggttgccatcctcattccccaccggaacagggagaaacacctcatgtacttg
ctggaacatcttcaccccttcctgcagaggcagcagctcgactatggcatctatatcatc
caccaggctggaagtaaaaagtttaaccgagccagactcttgaatgtgggctacatagaa
gctctcaaggatgaggtttgggactgcttcatattccacgatgtggacctggtgcctgag
aacgactttaacctttacacatgtgaggaccagcccaagcacctggttgttggcaggaac
agcactggatacaggttacgttacagtggatattttgggggtgttactgccctcagcaga
gagcaatttttcaaggtgaatggattctctaacaactactggggatggggaggcgaagac
gatgacctcagactcagggttgagcttcataaaatgaaaatatcccgacccaagcctgaa
gtgggtaaatataccatgatcttccatactagagaccaaggcaatgaggtgaatgtggga
cgaatgaagctgttacaccaggtgtcacgagtctggaaaacagatggcttatcaagctgt
tcttacaaattactgtctgtggaatacaatcccttatatatcaacatcacagtggatttc
tgggctggtgtatga

DBGET integrated database retrieval system