KEGG   Castor canadensis (American beaver): 109694546Help
Entry
109694546         CDS       T04791                                 

Gene name
Zdhhc21
Definition
(RefSeq) palmitoyltransferase ZDHHC21
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109694546 (Zdhhc21)
Enzymes [BR:ccan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109694546 (Zdhhc21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 109694546
NCBI-ProteinID: XP_020032138
UniProt: A0A250YE01
Position
Unknown
AA seq 265 aa AA seqDB search
MGFRIHFVVDPHGWCCLAVIVCVWLFNVAIIPKIIILPHYEEGHIPGALVILFYGLAIFC
LVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC
PWINNCVGEDNHWLFLQLCFYTELLTSYALMFAFCHYYYFLPLKKRNLDLFIVRHELAIM
RFATLLGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTR
WKILWFIPFRQRQPLRVPYHFANHV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggtttccggattcactttgttgttgacccacatggctggtgctgcctggctgtgatt
gtctgtgtctggctattcaatgttgctatcattcccaagatcatcatccttcctcactat
gaggaaggacatattccaggcgcattagtaatactgttctatggccttgccatattttgt
ctggttgccttagtgagagcctcaataacggatccaggaagactccctgagaaccccaag
atcccacatggagaaagggagttctgggaattatgtaacaagtgtaatttgatgagacca
aagcgttcgcatcactgcagccgctgtggccactgtgtgaggagaatggaccatcactgt
ccatggataaacaattgtgttggtgaagataatcattggctttttctccagttgtgcttc
tacactgagcttctcacttcctacgcactgatgtttgctttctgccactattattatttt
cttccactaaaaaagcgtaatttggacctctttattgttagacatgaattggctataatg
agatttgctacattgttgggcattactatgttagttggaataactgggctcttttatacc
caactaattggcatcatcacagatacaacatctattgaaaagatgtcaaactgttgtgaa
gaaatatcgaggcctcgaaagccatggcagcagaccttctcagaagtttttggcactcgt
tggaagatcctgtggttcattcctttcaggcagaggcaaccactgcgagttccctaccac
tttgccaatcatgtctaa

DBGET integrated database retrieval system