KEGG   Castor canadensis (American beaver): 109694839Help
Entry
109694839         CDS       T04791                                 

Gene name
Gpx6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00480  Glutathione metabolism
ccan00590  Arachidonic acid metabolism
ccan01100  Metabolic pathways
ccan04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109694839 (Gpx6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109694839 (Gpx6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    109694839 (Gpx6)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109694839 (Gpx6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx CathepsinC_exc
Motif
Other DBs
NCBI-GeneID: 109694839
NCBI-ProteinID: XP_020032621
Position
Unknown
AA seq 220 aa AA seqDB search
MIQIWASCLFPLFLTGFAQETLKPQETKVDCNKTVTDTIYEYGAVTLNDKKYIQFKQYAG
KHVLFVNVASYCDLTAQYPELNALQEDLQHFNVIILGFPCNQFGKQEPGKNSEILSGLKY
VRPGGGFVPNFQLFEKGDVNGENEQKVFTFLKNSCPPTSELLGSSKHLFWEPFKVHDIRW
NFEKFLVGTDGVPVMRWFHKIPVNTVKLDILEYLKQYDTQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgattcagatctgggcctcttgtcttttccctctgttcctgactggcttcgctcaggag
actctgaagccacaagagacaaaggtggattgcaacaaaacagtgacagacaccatctat
gagtatggagctgtcaccctcaatgacaagaagtatattcagttcaagcagtacgcaggc
aagcatgtcctctttgtcaacgtggccagctattgtgatctgacagctcagtatcctgaa
ctgaatgctctgcaggaagaccttcagcatttcaatgtcatcatattgggctttccctgt
aaccagtttggaaaacaagaaccaggaaagaactcagagatcctctctgggctcaagtat
gtgcgtccaggtggtggctttgttcctaatttccagctcttcgagaaaggggatgtgaat
ggagaaaatgaacagaaggtctttaccttcctgaagaactcctgccccccaacctctgaa
cttttaggctcatcaaaacatctcttctgggagcccttcaaggtccatgacatccgctgg
aactttgagaagttcctggtggggactgatggagtccctgtcatgcgctggttccacaag
attccagtcaacacagtcaagttggacatcctagagtacctaaagcagtatgatacccag
tag

DBGET integrated database retrieval system