KEGG   Castor canadensis (American beaver): 109695148Help
Entry
109695148         CDS       T04791                                 

Gene name
Mgll
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00561  Glycerolipid metabolism
ccan01100  Metabolic pathways
ccan04714  Thermogenesis
ccan04723  Retrograde endocannabinoid signaling
ccan04923  Regulation of lipolysis in adipocytes
Module
ccan_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ccan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    109695148 (Mgll)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    109695148 (Mgll)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    109695148 (Mgll)
  Environmental adaptation
   04714 Thermogenesis
    109695148 (Mgll)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109695148 (Mgll)
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S33
   109695148 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Thioesterase PGAP1 Peptidase_S9 Abhydrolase_5 Abhydrolase_3 LIDHydrolase Chlorophyllase2 BAAT_C DUF1057 Abhydrolase_2 TMEM117
Motif
Other DBs
NCBI-GeneID: 109695148
NCBI-ProteinID: XP_020033114
Position
Unknown
AA seq 313 aa AA seqDB search
METGLEDPSTMPEESSPRRTPQSVPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYDDLAQMLMRLNLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDMVQKD
HPELPVFLLGHSMGGAIAILTAAERPGHFSGMVLISPLVIASPESATTFKVLAAKVLNLV
LPNMSLGPIDSSVLSRNKTEVDLYNSDPLICHAGLKVCFGIQLLNAVSRVERALPKLTVP
FLLLQGSADRLCDSKGAYLLMDSARSQDKTLKIYEGAYHVLHKELPDVTRSVFHEINMWV
SQRISMAGARSPP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagggcttgaagacccatccacaatgccagaggaaagttctcccagaaggacc
ccacagagcgttccataccaggatctaccccacctggtcaacgcggacggacagtacctc
ttctgcaggtactggaagcccaccggcacacccaaggctctcatctttgtgtcccacggt
gctggggagcactgtggccgctatgatgatctggctcagatgctgatgaggctgaacctg
ctggtgttcgcccacgaccatgttggccacggacagagtgagggggagaggatggtggtg
tctgactttcacgtcttcgtcagggatgtactgcagcatgtggacatggttcagaaggac
caccccgagctccctgtcttccttctgggccactccatgggaggtgccatcgccatcctc
acggccgcagagaggcccggccacttctctggcatggtcctaatttcacctctggtcatc
gccagccccgaatcagcaacaactttcaaggtccttgctgcaaaagtgctcaacctcgtc
ctgccaaacatgtccctggggcccatcgactccagtgtgctatcccggaacaagacagag
gttgacctttacaactcggaccccctcatctgccacgcggggctgaaggtgtgtttcggc
atccagctgctcaatgccgtctcgcgggtggagcgtgccctccccaagctgaccgtgccc
ttcctgctgctgcagggctctgctgaccgcctgtgcgacagcaaaggggcctacctgctc
atggactccgccaggagccaggacaagacgctcaagatctatgaaggtgcctaccacgtt
ctccacaaggagcttcctgacgtgacccgttccgtcttccacgaaataaacatgtgggtc
tctcagaggatatccatggcgggagctaggtccccaccctga

DBGET integrated database retrieval system