KEGG   Castor canadensis (American beaver): 109695658Help
Entry
109695658         CDS       T04791                                 

Gene name
Pik3c2a
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00562  Inositol phosphate metabolism
ccan01100  Metabolic pathways
ccan04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109695658 (Pik3c2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109695658 (Pik3c2a)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     109695658 (Pik3c2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 109695658
NCBI-ProteinID: XP_020033897
Position
Unknown
AA seq 1710 aa AA seqDB search
MAQISNNSGFKQSSSPSHPEPTRTKDVDKEEALQMEAEALAKLQKDRQVTDNQRGLPLSS
STRQRAQVFNAQDYDLMVFPESDSQKRAVDIDVEKLTQAELEKLLLDDSFETRKTPILPV
APVLSPSFSAQLYLRPTIQRGQWPPGLSGPSTYTLPSVYPSAYSKQAAFQNGFNPRMPPF
PSTEPIYLRLPGQSPYFSYPLTHATPFHPQGSLPIYRPLVSPDMAKLFDKIASTSEFLKN
GKARTDLEINSKATVSNLQVSPKPEDISKFDWLDLDPLSKPKVDSVEALDHEEKNVPCLL
AEDPWDAVLLEERLPVSCQLERKVNGKSLSGATVTRSQSLNIRSTQLTKSQGQMSQKDPN
GTSSLPTGSSLLQELEVQNEEVAAFCQSITKLKTKFPYTDHCTNPGYLLSPVTVQRNICG
ENASVKVSIEIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEE
VLQNNHCLGSHEHIQNCRKWDTEIKLQLLTFSAMCQNLARIAEDDETPVDLNKHLYQIEK
PYKEVMTRHPVEDLLDSYHNQVELVLQIENQHRAIDQLIKAVRKICSALDGVETPAITES
VKKLKRAVNLPRNKSANVTSLSGRGDDSKSSTGGMSFGSLNFSNYCCFLRELTFSFNLGS
LTPENPVQVSTDQLTAAVYDLLRLHANSSRSSCTPSSRNIKEAWSTTEQLQFTIFAAHGI
SSNWVSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPL
ESLLHLTLFGILNQSSGSSPDSNKQRKGPEALGKVSLPLFDFKRLLTCGTKLLYLWTSSH
TNSIPGTVPKKGYVMERIVLQVDFPSPTFDIIYTAPQVDRSITQQHNLDTLENDIKGKLL
SILHKDSSLGLSKEDKAFLWEKRYYCFKYPNCLPKVLASAPNWKWVNLAKTYSLLHQWPP
LCPLAALELLDSKFADQEVRSLAVTWIEGINDDELTDLLPQFVQALKYEIYLNSSLVRFL
LSRALGNIQIAHSLYWLLKDALHDTQFGTRYEHVLGALLSVGGKGLREELSKQTKLVQLL
GGVAEKVRQASGSARPVVLQRSMERIQSFFLKNKCRLPLKPSLVAKELNIKSCSFFSSNA
VPLKVTMVNADPMGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLS
TGRDRGMVELVPASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSC
AGCCVATYVLGICDRHNDNIMLRSTGHMFHIDFGKFLGHAQMFGSFRRDRAPFVLTSDMA
YVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLFLNLLSLMIPSGLPELTSVQDLKYVRD
ALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTY
SFRQDGRIKEASVFTYHKKYNPDKHYIYVVRLLREGQLEPSFVFRTFDEFQELHNKLSII
FPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNNYLQSLMSASTDVAECDLVYTFFHPLLR
DEKAEGIARSAGAGPFSPTPGQIGGAVKLSVSYRNGTLFIMVMHIKDLVTEDGADPNPYV
KTYLLPDTHKTSKRKTKISRKTRNPTFNEMLVYNGYSKETLRQRELQLSVLSAESLRENF
FLGGITLPLKDFNLSKETVKWYQLTAATYL
NT seq 5133 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatatccaacaacagtggatttaaacagagttcatctccttcccatccggaa
ccaacaagaacaaaagatgtggacaaagaagaagcattgcaaatggaagcagaggcttta
gcaaaactgcaaaaggatagacaagtgactgacaatcagagaggcttgccgttgtcaagt
agcacaagacaaagagcacaagtttttaacgcacaggattatgatctcatggtgtttcct
gaatcagattcccaaaaaagggcagtagatattgatgtagaaaagctcacgcaagctgaa
cttgagaaactattgctggatgacagttttgaaactagaaaaacacctatattgccagtt
gctcctgttctgagcccctcattttcagcacagctctatcttagacccactattcagaga
ggacagtggccacctggattatctgggccttctacctacaccttaccttctgtctatcct
tcagcttacagtaaacaggctgcattccagaatggcttcaatccgagaatgcctcccttt
ccatctacagaacctatatatttaagacttccaggacagtctccatatttttcatatcct
ttgacacatgctacaccctttcatccacaaggaagcttaccaatatatcggccgctagtc
agtcctgacatggcaaagctatttgacaaaatagctagtacatcagaatttttaaaaaat
gggaaagcaaggactgatttggaaattaattcaaaagccacagtcagcaatctacaggta
tctccaaaacctgaggatatcagcaaatttgactggttagacttggatcctttaagtaag
cctaaggtggacagtgtggaagcattagatcatgaagagaaaaatgttccatgtttgcta
gcagaggatccttgggatgctgttcttcttgaagagagattaccagtaagttgtcagctg
gaaagaaaagtgaatggaaaatccctttctggggcaacagtaacaagaagccagtcatta
aatattcgatcaactcaacttacaaaatcccagggccaaatgtctcagaaagatccaaat
gggaccagtagtttgccaactggaagttctctcctacaagaacttgaagtacagaatgag
gaggtggcagctttttgtcaatccattacaaaattgaagaccaaatttccatacactgat
cactgtacaaatccaggctatttgttaagtccggtcacggtgcaaagaaacatatgtgga
gaaaatgctagtgtgaaggtctccattgaaattgaaggctttcaactgccagttaccttt
acatgtgatgtgagctctactgtggaaatcattataatgcaagccctttgctgggtgcat
gatgatttgaatcaagtggatgttggcagctatgttctgaaagtttgtggtcaagaggag
gtgctgcagaataatcattgccttggaagtcatgagcatattcaaaattgtcgaaaatgg
gacacagagattaaattacaactcttgaccttcagtgcaatgtgccagaatctagcccga
atagcagaagatgatgaaacccctgtggatttaaataaacatctgtatcaaatagaaaaa
ccttataaagaagtcatgacaagacatcctgttgaagatctcttagattcatatcataac
caagtggaactggttcttcaaattgaaaaccagcaccgagccatagatcaactaattaaa
gctgtaagaaagatctgtagtgctttagatggtgtagagactcctgccattacagaatca
gtaaagaagctaaagcgagcagttaacctgccaaggaataaaagtgctaatgtgacctca
ctatctggaagaggagatgatagcaagagctcaactggaggtatgtcttttggttcttta
aattttagcaattattgttgctttctcagagaattaacattttctttcaatttaggctca
ctgactcctgaaaatcctgttcaagtaagcactgaccagttaactgcggcagtttatgat
cttcttagacttcatgcaaattcaagtaggagttcctgcaccccaagtagcaggaatatc
aaggaagcatggtctacgacggaacagcttcagtttactatttttgctgcacatggaatt
tcaagtaactgggtatcaaattatgaaaaatactacttgatatgttctctatctcacaat
ggaaaggatctttttaaacccattcagtcaaagaaggttggcacttacaagaatttcttc
tatcttattaaatgggatgaactaatcatttttcccatccagatatcacaattgccattg
gaatcacttcttcatcttactctttttggaattttaaatcagagcagtggaagttcccct
gattctaataagcagagaaagggaccagaagctttgggcaaagtttctttgcctcttttt
gactttaaacggcttttaacatgtggaactaaacttctgtatctttggacttcatcacat
acaaattctattcctggaactgttcccaaaaaaggatatgtcatggaaagaatagtgtta
caggttgattttccatctcctacatttgatattatttatacagctcctcaagttgacagg
agcattacacaacaacacaacttagacacactggaaaatgacataaaagggaaacttctc
agtattcttcacaaagattcatcacttggactttctaaagaagataaagcctttttgtgg
gaaaaacgttattattgcttcaaatacccaaattgtcttcctaaagtactagcaagtgct
ccaaactggaaatgggttaatcttgccaaaacttactcactgcttcaccaatggcctcca
ttgtgcccactggctgccttggagcttcttgattcaaaatttgctgatcaagaagtgaga
tccctagctgtgacctggattgagggcattaacgatgacgagctaacagatcttcttcca
cagtttgtgcaagctttgaaatatgaaatttacttgaatagttcattagtacgcttcctt
ctgtccagggcattgggaaatatccagatagcacacagtttatattggcttctcaaggat
gccctgcatgatacacagtttggtacccgatatgagcatgtgttgggtgctctcctctca
gtaggaggaaaaggactcagagaagaactttctaagcagacaaaacttgtacaactttta
ggaggagtggcagagaaagtaaggcaggctagtggatcagccagaccggttgtccttcaa
aggagtatggaacgaatacagtccttttttctgaaaaataaatgtcgtctccctctcaaa
ccaagcctagtggcaaaagagttaaatattaagtcatgttctttcttcagttctaatgct
gtgcccctaaaagtcacaatggtgaatgctgatcctatgggagaagaaattaatgtcatg
tttaaggttggtgaggatcttcgacaagatatgttagctttacagatgataaagattatg
gataagatctggcttaaagaaggactggacctgaggatggtaattttcaaatgtctctca
actggcagagatcgaggcatggtggagctagttcctgcttcagataccctcaggaaaatc
caagtggaatatggtgtgacaggatcctttaaagataaaccacttgcagagtggctgagg
aaatacaatccttcagaagaagaatatgaaaaggcttctgagaattttatctattcttgt
gctggatgctgtgtggccacctatgttttaggcatttgtgatcgacacaatgataatata
atgcttcgaagcacaggacacatgttccacattgactttgggaagtttctgggccatgca
cagatgtttggtagcttcagaagggatcgggctccttttgtgcttacctctgatatggct
tacgtcattaatggcggtgaaaagcccaccattcgtttccagttgtttgtggacctctgc
tgtcaagcctacaatttgataagaaaacaaacaaacctctttcttaacctcctttcactg
atgattccttcgggattaccagaacttacaagtgttcaagatttgaaatatgttagagat
gcacttcaaccccaaactacagatgctgaagctacaattttcttcactaggctgattgag
tcaagtttgggaagcattgccacaaagtttaatttcttcattcacaaccttgctcagctg
cgtttttctggtctcccttctaatgacgagcccatcctttcattttcacccaaaacgtac
tcctttagacaagatggtcgtatcaaggaagcatctgttttcacataccataaaaagtac
aacccagataaacattatatttatgtagtccgacttttgagggaaggacagcttgaacca
tcatttgtattccggacattcgatgagtttcaagaacttcataataagctcagtattatt
tttccactttggaagttacctggctttcctaataggatggttctaggaagaacacacata
aaagatgtagcagccaaaaggaaaattgagttaaacaattatttacagagtttgatgagt
gcttcaacagatgtagcagagtgtgatcttgtttatacttttttccatcctttacttcgt
gatgagaaagctgaagggatagctaggtctgcaggtgcaggtccctttagtcctactcct
ggtcaaataggaggagcagtgaagttatcagtttcataccgaaatggtactcttttcatc
atggtgatgcacatcaaagatcttgttaccgaagatggggcagatccaaatccatatgtc
aaaacataccttcttccagatacccacaaaacatctaaacgtaaaacaaaaatttcacga
aaaactaggaatccaacattcaatgaaatgcttgtgtacaatggatatagcaaagaaact
ctgagacagagagaacttcagctaagtgtactcagtgcagagtctctacgggagaatttt
ttcttgggtggaataacactgcctttgaaagatttcaacttaagcaaagagacagttaag
tggtaccaactgactgcagctacttacctgtga

DBGET integrated database retrieval system