KEGG   Castor canadensis (American beaver): 109695769Help
Entry
109695769         CDS       T04791                                 

Gene name
Nt5c3b
Definition
(RefSeq) 7-methylguanosine phosphate-specific 5'-nucleotidase isoform X1
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00230  Purine metabolism
ccan00240  Pyrimidine metabolism
ccan00760  Nicotinate and nicotinamide metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109695769 (Nt5c3b)
   00240 Pyrimidine metabolism
    109695769 (Nt5c3b)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    109695769 (Nt5c3b)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     109695769 (Nt5c3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UMPH-1 HAD
Motif
Other DBs
NCBI-GeneID: 109695769
NCBI-ProteinID: XP_020034074
Position
Unknown
AA seq 300 aa AA seqDB search
MADEVGTLMKATVLMRQPQRVQEIVGALRRGGGDRLQVISDFDMTLSRFAYNGKRCPSSY
NILDNSKIISEECRKELAALFHHYYPIEIDPHRPIKEKLPHMVEWWTKAHNLLCQQRIQK
SQLAQVVGESTAMLREGYKIFFNTLCQNNIPLFIFSAGIGDILEEIIRQMKVLHPNIHIV
SNYMDFSEDGFLQGFKGQLIHTYNKNSCVCENSSYFQQLQGKTNILLLGDSMGDLTMADG
IPGVQNILKIGFLNDKVEEQRECYMDSYDIVLEKDETLDVVNGLLQYILSQGDHMEMQGT
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggtgggcaccctgatgaaggccacggtcctgatgcggcagccccagcgg
gtgcaggagatcgtgggcgctctccgccggggcgggggagaccggctgcaggtgatttct
gattttgacatgaccttgagcaggtttgcatataatggaaagagatgcccttcttcctac
aatattctggataacagcaagatcatcagtgaggagtgtcgaaaagagctcgcggcactc
tttcaccactattaccccattgagattgacccacaccggcctatcaaagaaaagttgcca
catatggtggagtggtggaccaaggcgcacaaccttttgtgtcagcagaggattcagaag
tctcagctagcacaggtggtcggagagtccactgcaatgctcagggaggggtataagata
ttcttcaacacactctgtcaaaacaacattcctcttttcatcttttctgccggcattgga
gacatcctggaagaaattatccgacagatgaaagtgctccaccctaacatccacattgtg
tctaactacatggacttcagtgaagacggtttcctacagggattcaagggccagctcatc
cacacgtacaacaagaacagctgtgtgtgtgagaactccagttacttccagcagcttcag
ggcaaaaccaacatcctcctgcttggagattccatgggggacctcactatggctgatggg
attcctggggtgcagaacattctcaagattggattcctaaatgacaaggtggaggaacag
cgggagtgctatatggattcctatgacattgtcttggagaaggacgagacactggacgtg
gtcaacgggctgctgcagtatatcctgagccagggggaccacatggagatgcagggcacc
taa

DBGET integrated database retrieval system