KEGG   Castor canadensis (American beaver): 109695961Help
Entry
109695961         CDS       T04791                                 

Gene name
Atg16l1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04136  Autophagy - other
ccan04140  Autophagy - animal
ccan04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109695961 (Atg16l1)
   04136 Autophagy - other
    109695961 (Atg16l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109695961 (Atg16l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccan04131]
    109695961 (Atg16l1)
   03029 Mitochondrial biogenesis [BR:ccan03029]
    109695961 (Atg16l1)
Membrane trafficking [BR:ccan04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    109695961 (Atg16l1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    109695961 (Atg16l1)
Mitochondrial biogenesis [BR:ccan03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    109695961 (Atg16l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 Ge1_WD40 KASH_CCD SH3_2 Fez1
Motif
Other DBs
NCBI-GeneID: 109695961
NCBI-ProteinID: XP_020034366
Position
Unknown
AA seq 637 aa AA seqDB search
MSSGLRAADFPRWKRHIAEELRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDTPNRHEISPGHDGTWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DREMQMNEAKIAECLQTISDLETECLDLRSKLQDLEIANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDEASDHTEDTSPVRAISRAATKRLSQPAGGLLDSITNIFGLSESPLLGHHSSSDAA
RRRSVSSFPVPQDNMDTHPVSGKDVRVPTTALCVFDAHDGEVNAVQFSPGSRLLATGGMD
RRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDHRLRHT
LTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVM
SGHFDKKIRFWDIRSESVVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNTVK
QTFSAPGFKCGSDWTRVVFRLVATPTPSLANLSPDGSYVAAGSAEGSLYVWSVLTGKVEK
VLSKQHSSSINAVAWAPSGLHVISVDKGSKAVLWAQP
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggtctccgcgctgccgatttcccccgctggaagcgccacattgcagaggag
ctgaggcgccgggaccgcctgcagaggcaggcgttcgaggagatcatcctgcagtataac
aagttgctggaaaagtcagatcttcattcagtgttggcccagaaactacaagctgaaaag
cacgacacaccaaacaggcacgagataagtcctggacacgatggtacatggaatgatagt
cagctacaagaaatggcccagttgaggattaagcaccaggaagaactgactgaattacac
aagaaacgtggggagttagctcagttggtgattgacctgaacaaccaaatgcagcagaag
gacagagagatgcagatgaatgaagcaaaaattgcagagtgtttgcagaccatctctgac
ctggagacagagtgcctagacctgcgcagcaagcttcaggaccttgagatagccaaccag
accctgaaggatgaatatgacgccctgcagatcacttttactgccttggaggaaaaactg
aggaaaactaccgaggagaaccaggagctggtcaccaggtggatggctgagaaggcccag
gaagccaatcgcctcaatgcagagaacgagaaggactccaggagacgtcaagcccggctg
cagaaagagcttgcagaagcagcaaaggaaccactgccagttgaacaggatgatgatatt
gaagtcattgtggatgaagcctcagatcacacagaggacacctcccccgtgagggccatc
agcagagcagctactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttggtctgtccgagtctccccttttgggacatcattcttcttctgatgctgcc
aggagacgctctgtctcttcctttccagtcccccaggacaatatggatacccatcctgtt
tctggtaaagatgtgagggtgccaactactgccttgtgtgtctttgatgcacacgatggg
gaagtcaatgctgtgcagtttagtccaggttctcggttactagccacaggaggcatggac
cgacgggttaagctgtgggaagcatttggagataaatgtgagttcaagggttccctatct
ggcagtaatgctggaattacaagcattgaatttgatagcgctggagcttacctcttagca
gcttctaatgattttgcaagccggatctggactgtggatgatcatcggttacggcacaca
ctcacaggacacagtgggaaagtgctgtctgctaaattcctgctggacaatgcacggatc
gtctcgggaagtcacgaccggaccctcaaactctgggatctacgcagcaaagtctgcata
aagacagtgtttgcaggatccagttgcaatgatattgtctgcacagagcaatgtgtaatg
agtggacattttgacaagaaaattcgtttctgggacatccgatcagagagtgtggtccga
gagatggagctgttggggaagatcactgccctggacttaaacccagaaaggacggagctc
ctgagctgctcccgggatgacctgctgaaagtcattgatctccgcacaaatactgtcaaa
cagaccttcagtgcccctggattcaagtgtggctctgactggacccgagttgtcttcagg
ttggtagccacacctacccccagcttggctaatctcagccccgacggcagctacgtggca
gcaggctcagctgagggctctctctatgtctggagtgtgctcacagggaaggtggagaag
gttctttccaaacagcacagctcctccatcaatgcggtggcgtgggccccctccggcttg
catgtcatcagtgtggacaaaggaagcaaagctgtgctatgggctcaaccttga

DBGET integrated database retrieval system