KEGG   Castor canadensis (American beaver): 109696127
Entry
109696127         CDS       T04791                                 

Gene name
Adamts13
Definition
(RefSeq) LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccan01002]
    109696127 (Adamts13)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     109696127 (Adamts13)
Peptidases and inhibitors [BR:ccan01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   109696127 (Adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_spondin Reprolysin_5 TSP1_CCN Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 109696127
NCBI-ProteinID: XP_020034606
Position
Unknown
AA seq 1297 aa
MNQLRPWVTWHSLHAASIGGVLAGAFFVLGCWGLSDFQQSFLQALEPEEVSSYFGPDAAF
AGHPSPHLRRRRWAAGDILHLELLVAVGPDVYQVHHEDTERYVLTNLNIGSELLRDPSLG
AQFRVHLVKLMILTEPEDAPTITANITSSLLSVCEWSQTVNPTDDTDPGHADLVLYITRF
NLELPDGNQQVRGVTQLGGICSPSWSCLITEDTGFDLGVTIAHEIGHSFGLDHDGEGKVG
RGCGPSGHVMASDGAALTGGVGLEWSACSRQQLRQLLSAGRLHCVWDPPRPQAGPSEHLP
IALPGLYYDAHEQCRVAFGPAAVGCTFARDGLDMCQALSCHTDSLDHSSCSRLLIPLLDG
TECGVEKWCSKGHCLSLAELSPVAAVHGHWSSWGPHSPCSRSCGGGVVTRRRRCNNPRPA
FGGRACVGAELQAEMCNTQACEKTQLEFMSEQCAQTDGQPLSLSPGSASFYRWSAAVQYS
QGDTLCRHMCRAVGESFIVRRGDSFLDGTRCVPSIPQEDGTLNLCVSGSCRTFGCDGRMD
SQQVRDVCQVCGGDNSTCSPQNGSFTAGRPREYVTFLMVTPNMTSVHIINRRPLFTHLAV
RIQGHYIVAGKASIFPNTTYPSLLEDSRMEYRVALTEDQLPHLEEIHIQGPAQEEMEIQV
FRRYGEEYGDLTRPDITFTYFQPKQRVAWVWAAMRGPCSVSCGAGLRWVTYNCLDQAQNK
WVETAQCQGSPQPTAWPEPCISVPCSPHWAAGDFGPCSASCGGGLRERLVRCVEAQGGLL
RTLPSARCRAVAQQPVVEVQTCNSQPCPARWEVTDPGPRMSTCGAGLDSRNTTCXAGAGC
LEAPATTGPCSTDEMPPTLEPCNRMVCPPGWGQLDATSPREEAPSPMGSARPGAQAAHVW
TPTVGPCSVSCGQGLMELRFLCMDSVLQTPLQDELCDLASKPGSRQEVCQAGPCPAQWEA
RALAPCPVTCGGGRVPLAVRCVRMNQGRPVPLPHAKCWPVPRPSPFEDCNLEPCPARWKV
TSLGPCSASCGLGIAIRSVACVQLDQGQDTEVDEVSCAALVRPQGSVPCLMADCIYRWHV
SSWTECSVSCGEGIQHRRDTCLGHQAHAPVPANFCWHLPKPATVRGCWARPCVEKGTFSL
LPHEEATVPRQTTAAVAGDSLQWQQPWAXARLLSLDPQPLGPQENLAKFRVCGRQHLEPL
GTIDMRGLGQADCVVAIGRPLGEVVTLQVLQSSLNCSAGELLLLWSRLTWRKMCWRLSGM
TFSSKTNTLVVRQRRVQPGSGVVLRYGSRPAPGTFFR
NT seq 3892 nt   +upstreamnt  +downstreamnt
atgaaccagcttcggccctgggtgacatggcactctctccatgcagccagcattgggggg
gtcctcgctggtgccttctttgtcctgggctgctgggggctctccgattttcagcagagt
tttcttcaggctctggagccggaggaggtgtcttcttactttggccctgacgctgccttc
gcaggccatccttcccctcacctccggagacggagatgggctgcaggggacatcctacac
ctggagctgctggtggctgtgggccctgatgtctaccaggtgcaccatgaggacacagag
cgctatgtgctcacaaacctcaacattggttcggaactgctgagagacccgtccctgggg
gctcagttccgagtacacctggtgaagctgatgattcttacggagcccgaggatgctcca
accatcacagctaacatcacctcatccctgctgagtgtctgtgagtggagccagacagtc
aaccccacagacgacacagatcctggccatgctgacctggtcctctacatcaccaggttt
aacctggagctgcctgacggtaatcaacaggttcggggggtcacccagttggggggcatc
tgctcaccctcttggagctgcctcatcacagaggacactggctttgacctgggggtcacc
atcgcccatgagattgggcatagcttcggcctggaccatgatggcgagggcaaggtgggc
agaggctgtgggcccagtggccatgtgatggcctcggatggtgctgctctcactggtggg
gtcggcctggagtggtcggcctgcagccgccagcagctgaggcaactgctcagtgcaggg
cggttgcactgtgtatgggacccgcccaggccacaggccggacccagtgagcacctgccc
attgcgctgcctggcctctactacgacgcccacgagcagtgccgcgtcgcctttggcccc
gcggctgttggctgcaccttcgccagagacggcctggatatgtgccaggctctctcctgc
cacactgactccctggaccacagcagctgcagccgcctcctcatccctctcctggacggg
acagaatgtggggtggagaagtggtgctccaagggtcactgcctctccctggcggagctc
agccccgtggcagcagtgcacgggcactggtcgagctggggcccccacagtccttgctcc
cgctcctgtggaggaggtgtggtcaccaggaggcggcggtgcaacaaccccagacctgcc
tttggggggcgtgcatgtgtcggtgctgaactccaggcggagatgtgcaacacccaggct
tgtgagaagacccagctggagttcatgtctgagcagtgtgcccagacagatggccagcct
ttgagcctctctcctggtagtgcctctttttaccgctggagtgctgccgtgcagtacagt
caaggggacaccctgtgccggcacatgtgccgagctgttggagaaagcttcattgtgagg
cgtggagatagtttcctggatgggacccgctgtgtgccaagtatccctcaggaggatggg
actctgaacctatgtgtgtctggcagctgcaggacatttggctgtgatggcaggatggac
tcccagcaggtacgggatgtgtgccaggtttgcggaggggacaacagcacgtgcagccct
cagaatggctctttcacagctgggagacccagagaatatgtcacattcctgatggtcact
cccaacatgaccagtgtgcacatcatcaaccgcaggcctctcttcacacacttagcggtg
aggatccaagggcactacattgtggctgggaaggccagcatcttccccaacaccacctac
ccatcgctcctggaggacagccggatggaatacagagtggctctaacagaggatcagctg
ccccacctcgaggaaatccacatccagggacctgcccaggaagagatggagatccaggtt
ttcaggcggtatggggaggaatacggggaccttacccgcccagacattaccttcacctac
ttccagcctaagcagcgggtggcctgggtgtgggctgccatgcgtgggccctgttctgtg
agctgtggggcaggactgcgctgggtgacctacaactgcttggaccaggcccagaacaag
tgggttgagactgcccaatgccaagggagcccacagccaactgcatggccagagccatgc
atctctgtaccctgctctccacactgggcagctggagactttggtccatgcagtgcttcc
tgtgggggaggcctacgggagcggctggtgcgctgtgtagaggcccagggtggccttctg
aggacactgccctcagcccggtgtagagcagtggcccagcagccggtggtagaggtgcaa
acctgcaactcccagccctgcccagccaggtgggaggtgacagaccctggcccacgcatg
tcaacctgtggagcaggcctggactctcggaacacgacatgtnaggcaggggcaggttgt
ctggaggcaccagcaactacgggtccctgctccacagatgagatgccgcccactctggag
ccctgtaacaggatggtgtgtcctccaggctggggtcagctggatgccacatctccacgg
gaggaggctccatccccaatgggcagtgccaggccgggggctcaggctgcacatgtgtgg
actcctacagtggggccatgttctgtctcctgtgggcaaggcttgatggagcttcgtttc
ttatgcatggactctgtcctccagacacctctccaggatgagctgtgtgacttggccagc
aagcctgggagccggcaggaggtctgccaggctggcccatgccctgctcaatgggaggcc
cgagccttggcaccatgcccagtgacctgtggagggggacgggtgccactggctgtgcgc
tgtgtaaggatgaaccaaggccgccctgtccctctgcctcatgccaagtgctggccagtg
ccccggcccagtccctttgaggactgcaacctggagccctgtccggccaggtggaaagtc
acgtctcttggcccatgctcagccagctgtggccttggcattgctatacgctcagtggcc
tgtgtgcagcttgaccaaggtcaggacactgaggtggatgaggtgtcttgtgcagctctg
gtgaggccccagggtagtgtcccctgtctcatggcagactgcatctatcggtggcacgtc
agctcctggacagagtgctctgtctcctgtggtgagggcatccagcaccgccgtgacacc
tgcctcggacaccaggcccacgcaccagtgccagccaacttctgctggcacttgcccaag
ccagccacagtacggggctgctgggctaggccctgtgtggagaaggggaccttcagcctg
ctgcctcatgaggaagccacggttcctagacagaccacggctgccgttgctggtgattct
ctacagtggcagcagccctgggcctgagcccgcctcctctccctagacccccagcctctg
gggccccaggaaaacctggcaaagtttcgtgtctgtggcaggcaacacctggagcccttg
ggaaccattgacatgcgaggtctggggcaggcagactgtgtggtggcaattgggcggccc
ttgggtgaggtggtgaccctccaagttctccagagctccctcaactgcagtgcaggggag
ctgttgctgctttggagtcggctcacatggcggaagatgtgctggaggctgtctggcatg
actttcagctccaagaccaacacactggtggtaaggcagcgccgtgtgcagcctggaagt
ggagtggtgctacggtatgggagccggcctgctccagggactttcttcagag

DBGET integrated database retrieval system