KEGG   Castor canadensis (American beaver): 109696229
Entry
109696229         CDS       T04791                                 

Gene name
Rdh5
Definition
(RefSeq) LOW QUALITY PROTEIN: 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    109696229 (Rdh5)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     109696229 (Rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 109696229
NCBI-ProteinID: XP_020034794
Position
Unknown
AA seq 318 aa
MWLPLLLGALLWAVLWLLRDQQTLPTSDAFVFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAENLQQMASSRLHTTLLDVTDPQSVQQVAKWVETHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFHQVLNVNTLGPIGVTLALLPLLQQAQGRVINITSVMGRLSANGGGYCVSKF
GLEAFSDSLRRDLAPFGVRVSIVEPGFFQXPVTNVETLEDMLKACWARLPPATQARYGEA
FLTTYLKVQRRIMNLICDPDLTKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVFTWVLPKPAQSVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggttgcctctgctgctgggtgccttgctctgggcagtgctgtggttgctcagggac
cagcagaccctgcccaccagcgatgcctttgtcttcatcacgggttgtgactcgggcttt
ggacgccttctggcactgcgattggaccagaggggcttccgagtcctggccagctgcctg
accccctctggagcagagaatctacaacagatggcctcttcccgcctccacaccactctg
ctggatgtcactgatccccagagtgtacagcaggtagccaagtgggtggagacacacgta
aaagaagcagggctttttggtctggtgaataatgctggtgtggctggtatcattgggccc
acaccatggctgacacgagatgatttccatcaagtcctgaatgtgaacacattgggtccc
attggggtcacccttgccctgctacccctgctacagcaggcccagggccgggtgatcaac
atcaccagcgtcatgggccgcctgtcggccaatggtgggggctactgtgtctccaagttt
ggcctggaggccttctccgacagcttgaggcgggacctggctccttttggggtacgagtt
tccattgtggagcctggcttcttccaanaccctgtgaccaacgtggagactttggaggac
atgctgaaggcctgctgggcccgactacctccagccacacaggcccgctatggggaagcc
ttccttaccacatacctaaaggtacagcgacgcatcatgaacctgatctgcgacccggac
ctaaccaaggtgagcagatgcctggagcatgccctgactgctcgtcacccccgaacccgc
tacagcccgggctgggatgccaagctgctctggctgcctgcctcctatctgccagccagc
ctggtggatgctgtattcacctgggtccttcccaagcctgcccagtcagtctactaa

DBGET integrated database retrieval system