KEGG   Castor canadensis (American beaver): 109697381
Entry
109697381         CDS       T04791                                 

Gene name
Ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109697381 (Ankrd53)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    109697381 (Ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3
Other DBs
NCBI-GeneID: 109697381
NCBI-ProteinID: XP_020036538
Position
Unknown
AA seq 653 aa
MALEPSPLSLELFFLEGVRIQATVEVKVNVKPFWCGIGNPYQQLSELRAVLDAVSRAIGQ
GGWGGVGLEPAAGLGVGGRQGPSILTPTLTLAAWKAVADNLEDDLEAAADSCAAPVGDAA
GSARRPSGLGERGQLTNLWMASGSGASLWARAGARRSGGEERRGTQPWQRAEKARRSSAL
SKESRCGVKALATRAPLRWPPSPPPLTPPRADDSTTEPSDPRAIANYSELFAAEVGNVEW
LRFCLNRDRRGITTDGKGFAAIHFAAQQGKLLCMQVLVEEYKFPVDLLTHNRQTPLHLAI
RKDNKTMTLPCMHYLLKKGADINAQTCNGSTALHLAAFEGLLGCIKVLVQSGANVYAQDA
IGCKPIDYCKIRNYRACARFLKDAMWKRDKKDFACEMEKLKCLKDKLTLMEHDYLIECQK
EQKIQRQANFKKWLRSKYKCQTLVPNTKQEAGAQPWSSAHSKTPRTQISKTFQCSVEARL
LSILQPKVLPKPIYKWPAISRPKSWNLSNNPARSPATDISCPQGIRLGVHPDHHKEHDFS
SFLEVNRDADDHVLLRTVDGHLVAPVPQLPFEMIIRALYPRVQPYRMKVPQGLYPISIVN
VLKKRHLGKDTFWTDTLAMNLRETFDEAFLTALQAHQVLPTLPSPLITPIKLF
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggccctggagccatctccgctaagcttggaactgttcttcttagaaggagtgagaatt
caagcaacagtggaagtgaaagtgaatgtaaaacctttctggtgtgggattggaaaccca
tatcaacagttaagtgagctgcgtgctgtgttggatgctgtttccagggcaataggccag
ggcggctggggaggggtcggcttggaaccagcggcggggctgggggttggtggcagacag
ggaccctcgattctgaccccgaccctgaccctcgcggcctggaaggccgttgcggacaac
ctggaggacgacctggaggcggctgccgacagctgtgcagcgcccgtgggggatgctgcg
gggagcgcacggcgcccctccgggctgggggagcgcggccagcttaccaacctctggatg
gcctcggggagcggcgcctctctgtgggctagggccggggcccggcgctccggcggggaa
gaacggagaggcacgcagccctggcagcgggcagagaaagcccgccggagcagcgccctg
tccaaggagtccaggtgcggggtgaaggccctcgccacgcgggcaccccttcgctggccg
cccagcccacccccactcaccccgccccgcgctgatgacagcaccaccgagccatcggat
cccagggccatcgcgaactactctgagctgttcgccgcagaggtgggcaatgtggaatgg
ctgcggttctgtctgaatcgggaccgcaggggaatcaccaccgatggcaagggcttcgct
gccatccacttcgcagcccagcagggcaagcttctttgcatgcaggtcttagtagaggaa
tacaagtttcctgtggatttgctcacccacaatcgccagacccctctgcaccttgccatc
cgtaaagacaacaagaccatgactctcccctgcatgcactacttgctcaagaaaggggca
gacatcaatgctcagacatgcaacggctccacagccctgcacctggcagcctttgagggc
ctgctgggctgtataaaggtcctggtacagagtggggccaatgtttatgcccaagacgcc
atcggctgcaagcccattgactactgcaaaatacggaactaccgcgcctgtgctcggttc
ttgaaggatgccatgtggaaacgggacaagaaggactttgcctgtgagatggagaaactg
aagtgcctcaaggacaagctgaccctcatggagcacgattacctgattgagtgccaaaaa
gaacagaaaattcagagacaagctaatttcaaaaagtggctccgttccaagtataaatgc
cagaccctggtacccaacaccaagcaagaggctggtgcccaaccttggtcctctgcccac
tccaagactccaagaactcagatttccaagaccttccaatgctcagtggaggcacgcctg
ctgagcatactgcagcctaaggtgctgcccaagcccatctacaagtggcccgccatcagt
cggcccaagtcatggaatcttagtaataaccctgccagatcccccgctacagatatcagc
tgcccacagggcatccgcctgggcgtgcatccagaccaccacaaggagcatgacttcagc
agctttttggaggtgaatagggatgcagatgaccatgtacttctgcgcacagtggatggc
cacttggtggcgcctgtgccccagctgccttttgagatgataatccgtgcactataccca
agggtacagccatacaggatgaaggtgccccagggcttatatcccatcagtatagtgaac
gtgctcaagaagcgacacttgggcaaggataccttctggactgacactctggctatgaac
cttcgtgagacatttgatgaagccttcctgacagccttgcaagctcatcaggtgctcccc
accctaccctcccccctcatcacccccataaagttattttaa

DBGET integrated database retrieval system