KEGG   Castor canadensis (American beaver): 109697528Help
Entry
109697528         CDS       T04791                                 

Gene name
Got1
Definition
(RefSeq) aspartate aminotransferase, cytoplasmic
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00220  Arginine biosynthesis
ccan00250  Alanine, aspartate and glutamate metabolism
ccan00270  Cysteine and methionine metabolism
ccan00330  Arginine and proline metabolism
ccan00350  Tyrosine metabolism
ccan00360  Phenylalanine metabolism
ccan00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccan01100  Metabolic pathways
ccan01200  Carbon metabolism
ccan01210  2-Oxocarboxylic acid metabolism
ccan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109697528 (Got1)
   00270 Cysteine and methionine metabolism
    109697528 (Got1)
   00220 Arginine biosynthesis
    109697528 (Got1)
   00330 Arginine and proline metabolism
    109697528 (Got1)
   00350 Tyrosine metabolism
    109697528 (Got1)
   00360 Phenylalanine metabolism
    109697528 (Got1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109697528 (Got1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccan01007]
    109697528 (Got1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccan04131]
    109697528 (Got1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109697528 (Got1)
Enzymes [BR:ccan01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     109697528 (Got1)
Amino acid related enzymes [BR:ccan01007]
 Aminotransferase (transaminase)
  Class I
   109697528 (Got1)
Membrane trafficking [BR:ccan04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109697528 (Got1)
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109697528 (Got1)
  Exosomal proteins of other body fluids (saliva and urine)
   109697528 (Got1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 109697528
NCBI-ProteinID: XP_020036781
UniProt: A0A250Y084
Position
Unknown
AA seq 413 aa AA seqDB search
MAPPSLFADVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQK
IANDNSLNHEYLPILGLAEFRTCASHLALGDDSPALKEKRVGGVQCLGGTGALRIGAEFL
ARWYNGTNNTNTPIYVSSPTWENHNAVFTAAGFKDIRTYHYWDAKKRGLDLQGFLNDLEN
APELSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGDLDKDAWA
IRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKESEGILRVLSQMEKIVRITWSNPP
AQGARIVASVLSNPELFKEWTGNVKTMADRILTMRAELRARLEALNTPGTWSHITEQIGM
FSFTGLNPKQVEYLVNEKHIYLLPNGRINMCGLTTKNIDYVANSIHEAVIKIQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcacctccgtcactcttcgctgatgttccccaggcccaacccgtcttggtctttaag
ctcaccgccgacttccgggaggatccagacccccgcaaggtcaacctgggggtgggagcc
tatcgcaccgatgattgccagccctgggttttaccggttgtgagaaaggtggagcagaag
attgctaatgataacagcctcaaccatgagtatctgcccatcctgggcctagcagagttc
cggacctgtgcgtctcaccttgcccttggggatgacagtccagctctcaaggagaagcgg
gtaggaggtgtacagtgtttggggggaacgggtgcacttcgaattggagccgagttctta
gcgcgatggtacaatggaacgaacaacacgaacactcccatctatgtatcctctccgacc
tgggagaaccataatgctgtatttactgctgctggctttaaagacattcggacctatcac
tattgggatgcaaagaagagaggccttgacctccagggtttcctgaatgatctggagaat
gctcctgagctctccatctttgtcctccacgcctgtgcacacaacccaacagggaccgac
ccgactccagagcagtggaaacagattgcttccgtcatgaagcgccgctttctgttcccc
ttctttgactcagcctatcagggcttcgcatctggagatctagacaaagacgcctgggcc
attcgctattttgtgtctgaaggctttgagttcttctgtgctcagtccttctccaagaac
ttcgggctctataatgagcgagttgggaatctgaccgtggttggaaaagaatctgagggc
atcctgcgggtcctttcccagatggagaagattgtgcgaattacttggtccaatcccccc
gcccagggagcacgaatcgtggcctccgtcctctctaaccctgagctctttaaggagtgg
acaggtaacgtgaagacaatggccgaccggattctgaccatgagagctgaactcagggca
cgattagaagccctcaatacccctgggacctggtctcacatcactgaacagattggcatg
ttcagcttcactgggttgaaccccaaacaagtggaatacctggtcaatgaaaagcacatc
tacctgctgccaaatggtcggatcaacatgtgtggcttaaccaccaagaacatagattat
gtggctaactccatccatgaagcagtcatcaaaatccagtga

DBGET integrated database retrieval system