KEGG   Castor canadensis (American beaver): 109697684Help
Entry
109697684         CDS       T04791                                 

Gene name
Dock6
Definition
(RefSeq) dedicator of cytokinesis protein 6 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccan04131]
    109697684 (Dock6)
Membrane trafficking [BR:ccan04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109697684 (Dock6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 109697684
NCBI-ProteinID: XP_020037028
UniProt: A0A250Y8C1
Position
Unknown
AA seq 2082 aa AA seqDB search
MAAAERRAFAHKINRTVAAEVRKQVSRERSGSPHSSRRSSSSLGVPLMEVIEPLDFEDVL
LSRPPDVEPGPLRDLVEFPADDLELLRQPRECRTTEPGIPEDGKLDAQARAAVEMYTEDW
VIVCRRYQHLSAVYSPITTETQRERQKGLTRQVYEQDASGDERSGPEDTEDSRRCSGSPE
DTPRGSGASGIFDLRNLAADSLLPSLLERAAPEDVDRRNEALRRQQRPRALLTLYPAPDE
DEAVERCSRPEPPHEHFGQRILVKCLSLKFEIEIEPIFGILALYDVREKKKISENFYFDL
NSDSMKGLLRAHGTHPAISTLARSAIFSVTYPSPDIFLVIKLEKVLQQGDISECCEPYMV
MKEVDTAKNKEKLEKLRLAAEQFCTRLGRYRMPFAWTAVHLANIVSSAGQADRDSDSEGE
RRPAWTERRRRGPQDRANSGDDACSFSSFRPATLTVTNFFKQEAERLSDEDLFKFLADMR
RPSSLLRRLRPVTAQLKIDISPAPESPHFCLSPELLHVKPYPDPRGRPTKEILEFPAREV
YAPHTCYRNLLYVYPHSLNFSSRQGSVRNLVIRIQFMAGEDPSQALPVIFGKSSCSEFTR
EAFTPVVYHNKSPEFYEEFKLRLPACVTENHHLLFTFYHVSCQPRPGTALETPVGFTWIP
LLHHGRLRTGPFCLPVSVDQPPPSYSVLTPDVALPGMRWVDGHKGVFSVELTAASSVHPQ
DPHLDKFFTLVHVLEEGAFPFRLKDTMVSESTVEQELRTSLTTLRLASPEPLVAFSHHVM
DKLVHLIIRPPVIGGQMVNLGRGAFEAMAHVVSLVHRSLEAVQDARGHCPLLAAYVHYAF
RLPGTEPSLPGGAPLVTVQAATLAHGSGRPTSLYLARSKSISSSNPDLAVAPGSVDDEVS
RILATKGVDRSHSWVNSAYAPGGSKAVLRRALPYCGADPRQLLHEELALQWVVSGSAVRE
AVLQHAWFFFQLMVKSMALHLLLGQRLDTPRKLRFPGRFLDDIAALVGSVGLEVITRVHK
DAELAERLNASLAFFLSDLLSLMDRGFVFSLVRAHYKQVATRLQSAPNPATLLTLRMDFT
RILCSHEHYVTLNLPCCPLSPPASPSPSVSSTTSQSSTFSSQAPDPKVTSMFELSGPFRQ
QHFLAGLLLTELALALEPEAEGTFLLHKKAISAVHSLLCSHDTDPRYADATVKARVAELY
LPLLSLARDTLPRLHDFAEGPGQRSRLASILDSDTEGEGDIGGTINPSVAMAIAGGPLAP
GSRTSISQGPTPASRSGCPLSAESSRTLLVCVLWVLKNAEPALLQRWAADLALPQLGRLL
DLLYLCLAAFEYKGRKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMVRRSRERSPF
GNQENVRWRKSITHWRQTSDRVDKTKDEMEHEALVDGNLATEASLVVLDTLEIIVQTVML
SDARESVLGAVLKVVLYSLGSAQSASFLQHGLATQRALVTKFPELLFEEDTELCADLCLR
LLRHCGSRISAIRTHASASLYLLMRQNFEIGHNFARVKMQVTMSLSSLVGTTQNFSEEHL
RRSLKTILTYAEEDVGLRDSTFAEQVQDLMFNLHMILTDTVKMKEHQEDPEMLLDLMYRI
ARGYQGSPDLRLTWLQNMAGKHAELGNHAEAAQCMVHAAALVAEYLALLEDSRHLPVGCV
SFQNISSNVLEESAISDDILSPDEEGFCSGKHFTELGLVGLLEQAAAYFTMGGLYEAVNE
VYKNLIPILEAHRDYKKLAAVHGKLQEAFTKIMHQSSGWERVFGTYFRVGFYGSRFGDLD
EQEFVYKEPSITKLAEISHRLEEFYTERFGDDVVEIIKDSNPVDKSKLDPRKAYIQITYV
EPHFDTYELKDRVTYFDRNYGLRAFLFCTPFTPDGRAHGELPEQHKRKTLLSTEHAFPYI
KTRIRVCHREEMVLTPVEVAIEDMQKKTRELAFATEQDPPDAKMLQMVLQGSVGPTVNQG
PLEVAQVFLADIPEDPKLFRHHNKLRLCFKDFCKKCEDALRKNKALIGPDQKEYHRELER
HYCRLREALQPLLTQRLPQLLAPTPASLRNSLNRASFRKTDL
NT seq 6249 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgccgagcgccgcgccttcgcgcacaagatcaacagaacggtggctgcagag
gtgcgcaagcaggtgtcccgagaacgcagtggttctccccactccagccgtcgctccagc
agctccctgggggtccctctgatggaggtcattgagcccctggactttgaggatgtgctc
ctgagccggccaccagatgttgaacctggacccctcagggacctggtagaatttccagct
gatgacttggaactgttgcgacagccccgggaatgccggaccacggagcctgggattccc
gaggatggaaaactggatgcccaggcgagggctgcggtagagatgtacacagaggactgg
gtcatcgtgtgccgaaggtaccagcacctgagtgccgtgtacagccccatcaccacggag
acgcagcgagagcgacagaagggcctcacccgccaagtctatgagcaggatgcctctgga
gatgagcggtctggccctgaggacacggaagactcccgccgctgctcaggctccccagag
gacacccctcgaggcagcggcgcctccggcatctttgacctgaggaacctggccgcggac
tccctgctgccctcgctgctggagcgggcagcaccggaggacgtagaccggcgcaatgag
gccctgcggcggcagcagcggccccgggcactcctcaccctctaccccgcgcctgatgag
gatgaggctgtggaacgctgtagccgccctgagccaccccatgagcactttggacagagg
atcctggtcaaatgtctatcactcaagtttgagatagaaattgaacccatctttggcatt
ttggccctgtatgatgtgcgggagaaaaagaagatttcagaaaatttctactttgacctg
aactcagactccatgaaggggctgcttcgggcccacggcacccaccccgccatctccact
ctggcacgctccgccatcttttctgtgacttacccctcacctgacatcttcctggttatc
aagctggagaaggttctgcagcaaggggacatcagcgagtgctgcgaaccctacatggtg
atgaaggaggtggacacagccaagaacaaagagaagctggagaagctgcgcctggccgcc
gagcagttctgcacccgcctggggcgctaccgcatgcccttcgcctggacggccgtgcac
ctggccaacatcgtgagcagcgcggggcaggctgaccgcgactcggactcggaaggcgag
cgccgacctgcctggactgagcgccgccgtcgggggccccaggaccgagcaaacagcggg
gacgatgcctgcagcttctctagcttccgcccggccacactgactgtcaccaacttcttc
aagcaggaggctgaacggctcagtgatgaggatctcttcaaattcctagcggacatgcga
cggccatcatctctgctgcggcgcctgcgccctgtgaccgctcagctgaagatcgacatt
tccccggcccctgagagcccccacttctgcctgtcccctgagctgcttcatgtcaagccc
tatcctgaccccaggggccggcccaccaaggagatcctggagttcccagctcgtgaggtc
tatgcgccccacacctgctacaggaacttgctgtacgtgtacccgcacagcctcaatttc
agcagccgccagggctctgtgcgcaacctcgtcatccgcatccagttcatggcgggcgag
gaccccagccaggccctgccggtcatcttcggcaagtccagctgcagcgaattcacccgc
gaggccttcacaccagtggtctatcataacaagtcccctgaattctacgaggagttcaag
ctacgacttccagcctgtgtgaccgagaatcaccacctgctcttcaccttctaccatgtc
agttgccagccccggccaggcacggccctggagacgcccgtgggcttcacgtggatcccg
ctgctgcaccatggccgcctgcggaccggccccttctgcctcccggtgtcagtggaccag
cccccacccagctactctgtgctcacacccgacgtggcgctgccgggcatgcgctgggtg
gatggccacaagggcgtgttcagcgtggagctgacagctgcgtcctctgtgcacccccag
gatccccacttggataagttcttcaccctggtgcatgtcctggaggagggggcctttccc
ttccggctcaaggacaccatggtgagtgagagcactgtggagcaggagctgcgtaccagc
ctcaccacgctgcgcctcgccagccccgagcccctggtggccttctcccaccacgtcatg
gacaagcttgtgcatctgatcatacggccccctgtcattggcggccagatggtgaacctg
ggccgtggagcctttgaagcaatggcccatgtagtcagccttgtccaccggagcctggag
gcggtccaggatgcccgtggtcactgtccgctgctggctgcctacgtccactatgccttt
cgcctccctggcactgagcccagcctcccaggtggggcccctctagtgaccgtgcaggct
gccacactggcccacggctctggccgccccacaagcctctacctagcccgttctaagagc
atcagtagcagcaacccggacctggccgtggcccctggctctgtggacgacgaggtttcc
cgcatcctggccaccaagggcgtcgatcgctcacactcctgggtgaattctgcttatgct
ccgggaggcagcaaggctgtgctgcggcgggcgctcccttactgcggggctgaccccaga
cagctgcttcacgaggagctggctctgcagtgggtggtcagcggcagcgcggttcgtgag
gccgtcctgcagcacgcgtggttcttcttccagctcatggtgaagagtatggccctgcac
ctgcttctgggccagcggctggacacgccccgcaagctgcgattccctgggcgcttcctg
gatgacattgcggccctagtgggctctgtgggcctggaggtcatcacccgggtccacaag
gatgcggagctggcagagcgcctcaatgccagcctggccttcttcctcagtgacctcctg
tccctaatggatcggggcttcgtcttcagcctggtccgagctcactacaagcaggtggcc
acacggctgcagtcggcccccaacccagcgacactgctgaccttgcgcatggacttcacc
cgcatcctatgcagccatgagcactacgtgaccctcaacctcccttgctgccccctgtcg
cccccggcctcgccctccccctccgtgtcctccaccacctcccagagctccaccttctcc
agccaggccccagaccccaaggtgactagcatgtttgagctgagcgggccattccggcaa
cagcactttctagcagggctcctgctgacagagctggctctggccctggaacctgaggcc
gaggggacattcttattgcacaagaaggccatcagtgccgtgcacagcctgctctgcagc
cacgacactgacccccgctatgctgatgccaccgtgaaggccagggtggctgagctgtac
ctgccgctgctgtcgcttgcacgggatacactgcctcggctacatgactttgctgagggc
ccaggtcagcggtcaagactggcctccattctggactcagacacagaaggtgaaggggac
attggaggtaccatcaacccttctgtggccatggcgattgctggtggccccttggcccct
ggctcccggaccagtatctcccaggggcccacaccagcatctcgctcaggctgtcccctc
tccgctgagtccagtcggaccttgctggtgtgcgtgctgtgggttctgaaaaatgcagag
ccggccctcctgcagcgctgggctgctgacctggccctgccccagctgggacgcctcttg
gacctgctctacctctgtttggctgcctttgagtacaaggggagaaaggcctttgagcgc
atcaatagcctcacattcaagaagtctctagatatgaaagccaggctggaggaagccatc
ctgggcaccatcggggcccgacaagagatggtgcggaggagccgtgaaaggagcccgttt
gggaaccaggagaatgttcggtggcgcaagagcatcacgcactggaggcaaacctcggac
cgtgtggacaagaccaaggatgaaatggaacatgaggccttggtggatgggaacctggcg
acggaggccagcttggtggttctggatacactagaaatcattgtgcagacagtgatgctg
tcagatgcccgggagagcgtcttgggtgcagtgctaaaggttgtgttgtacagcctgggg
agtgcccagagtgcctcgttcttgcagcatggcctggccacccagcgggccctggtgact
aagttcccggagcttctgttcgaggaggacacggagctgtgtgctgacctgtgcctcagg
ctcctgcgacactgcggcagccgcatcagtgccattcgcacgcacgccagcgcctcgctc
tacctgctgatgcgccaaaacttcgagatcggccacaactttgcccgcgtgaagatgcag
gtgaccatgtccctgtcgtccctcgtggggacgacccagaacttcagtgaagagcacctg
agacgttccctgaagaccatactcacctacgccgaggaggatgtaggactgagggacagc
acctttgcggagcaggtccaggacctgatgttcaacctgcacatgatcctgaccgacacg
gtgaagatgaaggagcaccaggaggatccagagatgctcctggacctcatgtaccggatc
gcccgaggctaccagggctccccggatctgaggctgacatggctgcagaacatggcgggg
aaacacgcagagcttggaaaccacgctgaggccgcccagtgcatggtgcacgcagctgcc
ctggtggctgagtacctcgccctgctggaggacagccgccacctgcccgtgggctgtgtg
tccttccagaacatctcatccaatgtgctggaggagtccgccatctccgatgacatcctg
tcgcccgacgaggagggcttctgctcggggaagcacttcacggagctgggactggtgggt
ctgctggagcaggcggctgcctacttcaccatgggtggactctatgaggctgtgaatgag
gtctacaaaaacctcatccccatcctggaagcccaccgagactacaagaagctggctgcc
gtgcacggcaaactgcaggaggctttcaccaagatcatgcaccagagctctggctgggag
cgcgtatttggaacgtatttccgggtgggcttttacggctcccgctttggggacctggat
gagcaggagtttgtgtacaaggagccatcgatcacaaagctggcggagatctcacaccgg
ctggaggagttctacaccgagaggttcggggatgatgtcgtggagattatcaaagactct
aatcccgtggacaagtccaagctcgatccacgaaaggcctatatccagatcacatacgtg
gagccacactttgacacctacgagctcaaggaccgtgtgacctacttcgaccgcaactac
gggttgcgcgccttcctgttctgcacgcccttcacgcccgacgggcgcgcgcatggcgaa
ctgccggagcagcacaagcgcaagacgctgctcagtacagagcacgccttcccctacatc
aagacgcgcatccgcgtgtgccaccgggaggagatggtgctgacgccagtggaggtggcc
atcgaggacatgcagaagaagacacgggagctggcttttgccacagagcaggaccctcca
gatgctaagatgttgcagatggtgttgcagggatccgtgggtcccactgtgaaccagggt
cccttggaggtagcacaggtgtttttggcagacatcccagaagaccctaaactcttccgg
catcataacaaacttcggctgtgtttcaaggacttctgcaagaagtgtgaggacgcactg
cggaagaacaaggccctgattgggccggaccaaaaagagtaccacagagaactggagcgc
cactactgccgcctacgggaggctcttcagcccctccttacccagcgcctgccccagctg
ctggcacccaccccagccagtctcaggaactcactgaacagagcaagtttccgaaagaca
gatctctga

DBGET integrated database retrieval system