KEGG   Castor canadensis (American beaver): 109698045Help
Entry
109698045         CDS       T04791                                 

Gene name
Zdhhc2
Definition
(RefSeq) palmitoyltransferase ZDHHC2 isoform X1
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccan04131]
    109698045 (Zdhhc2)
Enzymes [BR:ccan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     109698045 (Zdhhc2)
Membrane trafficking [BR:ccan04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    109698045 (Zdhhc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 109698045
NCBI-ProteinID: XP_020037584
Position
Unknown
AA seq 366 aa AA seqDB search
MAPSGSGSVRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENISEQVVCLMAYHL
LFAMFVWSYWKTIFTLPMNPSKEFHLSYSEKELLEREPRGEAHQEVLRRAAKDLPIYTRT
MSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL
YCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS
TLEAFRSPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSLGDGCSFPTCLVNQD
PEQPSTPAGMNSATKIPENHQFPAKPLRESQSHLLTDSQCWTESNTNPGKGKAGMSNPAL
TMENET
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctcgggctcgggcagcgtcaggcggcggtgccggcgggtgctgtactggatc
ccggtggtgttcatcagcctcctgctgggctggtcctactacgcctacgccatccagctg
tgcatagtgtccatggaaaacattagcgaacaagttgtgtgcctgatggcttatcatcta
ctttttgcaatgtttgtctggtcatactggaaaactatctttacattaccaatgaatcct
tcaaaggaattccacctttcttactcagagaaagaattgttggagagagagccaagggga
gaagcccatcaggaagttcttaggcgagcagccaaagaccttcccatctacaccaggacc
atgtctggagcaatccgatattgtgacagatgccaacttataaaaccggatcgctgccat
cattgttccgtctgtgataaatgtattttgaagatggatcatcattgcccatgggtgaac
aattgtgttggattttcaaattataaattcttcctccttttcttggcttactctcttctg
tactgcctttttattgctgctacagatttacagtattttatcagattttggacaaatggc
ctacctgatactcaagccaagttccatattatgtttttattctttgctgcagctatgttt
tctgtcagcttgtcttctctgtttggttatcattgttggctagtcagcaaaaataaatct
acattagaggcattcagaagtccagtatttcggcatggaacagataagaatggattcagc
ttgggtttcagtaaaaatatgcgacaagtttttggtgatgagaagaagtattggttgcta
cccattttttcaagtcttggtgatggctgctcctttccaacctgccttgttaaccaggat
cctgaacaaccatctacacctgcaggaatgaattcagcaactaaaattcctgaaaaccat
cagtttcctgccaagcctttgagagagtcccagagtcatcttcttactgattctcagtgt
tggacagagagtaacacaaacccaggaaaaggcaaagctggtatgagcaatcctgcatta
accatggagaatgagacttaa

DBGET integrated database retrieval system