KEGG   Castor canadensis (American beaver): 109698643Help
Entry
109698643         CDS       T04791                                 

Gene name
Gucy2f
Definition
(RefSeq) retinal guanylyl cyclase 2
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00230  Purine metabolism
ccan01100  Metabolic pathways
ccan04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109698643 (Gucy2f)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    109698643 (Gucy2f)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109698643 (Gucy2f)
Enzymes [BR:ccan01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     109698643 (Gucy2f)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   109698643 (Gucy2f)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor
Motif
Other DBs
NCBI-GeneID: 109698643
NCBI-ProteinID: XP_020038580
Position
Unknown
AA seq 597 aa AA seqDB search
MFLGPRLFPCLMLWFVVTSRLSGHHGLASSKLQRCMCLLALLSLLQQVWAFPYKIGVVGP
WACDPLFSKALPEVAAGLAIERINQDPLFDGGYSFEYVILNEDCQTSRALSSFISHHQMA
SGFIGPANPGYCEAASLLGNSWDKGIFSWACVNYELDNKNSYPTFSRVLPSPIRVLVTVM
KYFQWAHAGVISSDEDIWVNTANRVSSALRSHGLPVGVVLTTGQDSQSIRKALQQIHQAD
RICIIIMCMHSALIGGETQMRLLEWAHDLKMTDGTYVFVPYDALLYSLPYKHTPYQVLRN
NPKLREAYDAVLTITVESQEKTFYQAYMEAAASGEIPEKPESDQVSPLFGTIYNSIYFIA
QAVNNAMKENGRASAASLVQHSRNMQFFGFNQLIRTDSDGNGISEYVILDTNWKEWELHR
TYTVDMETELLRFGGTPIHFPGGRPPRADAKCWFAEGKICRGGIDPAFAMMVCLALLIAL
LCINGFAYFIRRHINKIQLIKGPNRILLTLEDVTFINPHFGSKRGSRASVSFQIISEVQS
GRSPQLSFSSGSLTPVTYEKSNIAIYEGDWVWLKKIPPGDFGDIKSIKSSASDVFEM
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgggacccaggctttttccttgccttatgctctggtttgtggttaccagcaga
ctgtcaggacaccatggccttgcatcttccaagctccagcggtgcatgtgcctcctggcc
cttctgtctcttctgcagcaggtgtgggcattcccctacaagataggggtggtgggccct
tgggcttgtgatccgttgttctcaaaggccttgcctgaggttgctgctggattagcaatt
gagcgaatcaaccaggatcctttgtttgacgggggttattcttttgaatatgtgattctc
aatgaagactgccagacttcgagggccctctccagttttatttcccaccaccagatggcc
tcaggatttattggacctgccaaccctggctactgtgaggcagcctccctcctgggaaac
agctgggacaaagggattttctcttgggcttgtgtgaattacgaattagacaataaaaat
agctacccgaccttttctcgggtactcccttctccaatccgggtgcttgtaactgtcatg
aagtatttccagtgggctcatgctggagtcatttcctcagatgaagacatttgggtgaat
acagccaatagagtctcaagtgctcttcggagccatggcctacctgtaggggtcgtcctg
actacaggacaagacagccaaagcattcggaaagctctccagcagattcaccaggcagac
cgaatttgcataatcatcatgtgtatgcattcagctttgattgggggagagacccagatg
cgcctcttggaatgggctcatgatctgaaaatgaccgatggaacttatgtgtttgttccc
tatgatgccctgctgtacagtttaccttataagcataccccctatcaggtcctgaggaac
aacccaaagctacgggaagcctatgatgctgtcttgaccattacagtagagtctcaagaa
aagaccttctatcaagcttatatggaagcagcagctagcggtgaaattcctgagaagcca
gagtcagatcaagtttcaccgttgtttggaaccatctacaattcgatttactttatcgca
caagctgtgaataatgctatgaaagaaaatggacgggctagtgctgccagcctggttcag
cattccagaaacatgcagttctttggattcaaccagttgataaggacagactcagatgga
aatggaatttcagaatatgtaattctggacaccaactggaaagaatgggaactccatagg
acctatactgtggatatggaaacggagctgctacggttcggagggacccctattcacttc
ccgggtggcaggcctcctagagcagatgcaaagtgctggtttgcagaagggaagatctgc
cgaggaggcatcgaccccgcctttgccatgatggtctgccttgctttgcttatagctttg
ctgtgtattaatggatttgcttactttataaggcgtcatataaataagatccagttgatt
aaaggacccaacagaatcctactgactttggaagatgtgacatttattaatccccacttt
ggcagtaagagaggaagtcgtgccagtgtaagcttccagatcatctcagaggttcaaagt
gggagatccccccagctctccttttcttcagggagtctaactccagttacttatgaaaaa
tccaacatagcaatttatgagggtgattgggtgtggctgaaaaagatccctcctggagat
tttggagacattaagtccatcaaatcaagcgcaagtgatgtgtttgaaatg

DBGET integrated database retrieval system