KEGG   Castor canadensis (American beaver): 109699393Help
Entry
109699393         CDS       T04791                                 

Gene name
Tyw3
Definition
(RefSeq) tRNA wybutosine-synthesizing protein 3 homolog
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccan03016]
    109699393 (Tyw3)
Enzymes [BR:ccan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     109699393 (Tyw3)
Transfer RNA biogenesis [BR:ccan03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    109699393 (Tyw3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 RRXRR Caenor_Her-1
Motif
Other DBs
NCBI-GeneID: 109699393
NCBI-ProteinID: XP_020039651
UniProt: A0A250XX89
Position
Unknown
AA seq 255 aa AA seqDB search
MERSAEFHRWKEQCLSKADLSRKGSVDEDVVGLVQLLNAREQFFTTSSCAGRVLLLDGVI
DGFQVQKQNCCWLLVTHKPCVKEDVMVALKKANGDAVLKFEPFVLHVQCRQLEDAQILHS
VAVDSGFRNSGITVGKRGKTMLAVRSTHGLEVPLSHKGKLMVTEEYIDFLLKIANQKMEE
NKKRIERFYNCLQHALERETVTKTKEENKSSTRTYKKKRNPEKAHGKYIAKENDEKLEND
DGDPEFSLTIFPEDY
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagcgcggagttccacaggtggaaggagcagtgtctgagcaaagccgacctc
agccgcaaaggcagcgtggacgaggacgtggtggggctcgtgcagctcctgaatgcgcgt
gagcagtttttcaccaccagttcctgcgctggccgcgtcctccttctggacggggttata
gatggtttccaggttcagaaacaaaactgttgctggctactagttacacacaaaccttgt
gtaaaagaggatgtgatggtagccctgaagaaagcaaatggtgatgccgttttgaaattt
gaaccatttgttcttcatgtgcagtgtcggcagttggaagatgcacagattctgcattca
gtggcagttgattctggtttcaggaactctggcatcacagtgggaaaaagaggaaaaact
atgttggctgtccggagtacacatggcttggaagttccattaagtcataagggaaaactg
atggtgacagaggaatatattgacttcctgttaaaaatagcaaatcaaaaaatggaggaa
aacaagaaaagaattgaaaggttttacaattgtctacaacatgccttggaaagagaaact
gttaccaagaccaaagaggaaaataaatcatccacccgtacttacaagaaaaaaagaaac
ccagaaaaagcacatggcaaatatattgctaaagaaaatgatgaaaagcttgaaaacgat
gatggtgatccagaattcagtcttactatcttccctgaagattactaa

DBGET integrated database retrieval system