KEGG   Castor canadensis (American beaver): 109699831Help
Entry
109699831         CDS       T04791                                 

Gene name
Abhd12
Definition
(RefSeq) LOW QUALITY PROTEIN: monoacylglycerol lipase ABHD12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccan01002]
    109699831 (Abhd12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109699831 (Abhd12)
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     109699831 (Abhd12)
Peptidases [BR:ccan01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   109699831 (Abhd12)
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   109699831 (Abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Abhydrolase_2 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 109699831
NCBI-ProteinID: XP_020040288
Position
Unknown
AA seq 398 aa AA seqDB search
MRKRTEPVTLEHERCAASGSSSSGSAAAALDADCRLKQNLRLAGKGSAEPRCAADPGMKR
TLGRRKGLWFRLRKILLCVLGFYIAIPFLVKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEXDVTIGVWHTIPAVWWKNAQGKDQMWFEDALASSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYNIAAPSRSFRDFKVQ
FIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPERQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggactgagcccgtcaccttggagcatgagcgctgcgccgcttcgggttcg
tcctcctccggctcggccgccgcggcgctggacgccgattgccgcctgaagcaaaacctg
cgcctggcgggcaaggggtcggctgagccgcggtgcgcggcggacccgggcatgaagcgg
acactgggcaggcgaaagggcctgtggttccgactgaggaagatacttctctgtgttttg
gggttctacattgccattccatttctcgtcaaactatgtcctgggatacaggccaaactg
attttcttgaattttgtgagggttccttattttattgacttgaaaaaaccacaggatcaa
ggtttgaatcatacctgcaattactacctccagccagagnaagatgtgaccattggagtc
tggcacaccatccctgctgtctggtggaagaatgcccaagggaaggaccagatgtggttt
gaggatgccttggcttccagccaccccatcattctgtatctgcatgggaatgcaggtacc
agaggaggtgaccaccgggtggagctctacaaggtgctgagttcccttggttaccacgtg
gtcacctttgactatagagggtggggtgactcagtaggaacgccatctgagcggggcatg
acgtatgacgcactccatgtttttgactggatcaaagcaagaagtggtgacaaccctgtg
tacatttggggccattccctgggcactggagtggcaacaaatctggtgcggcgcctctgt
gaacgagaaacacctcctgatgctcttatattggaatctccattcactaatatccgtgaa
gaagcaaagagccatccattttcagtgatatatcgatacttccctgggtttgactggttc
ttccttgatcccattacaagcagtggaattaaatttgcaaatgatgaaaatgtgaagcac
atctcttgtcccctgctcatcctgcatgctgaagacgacccagttgtgcccttccagctt
ggcagaaagctttacaacattgctgcaccatctcgaagtttccgagacttcaaagttcag
tttatcccgtttcactcagaccttggctataggcacaagtacatctacaagagccctgag
cttccacgaatactcagggaattcctagggaagtcagaacccgagcgccagcactga

DBGET integrated database retrieval system