KEGG   Castor canadensis (American beaver): 109700900Help
Entry
109700900         CDS       T04791                                 

Gene name
Eif3a
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109700900 (Eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccan03012]
    109700900 (Eif3a)
Translation factors [BR:ccan03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    109700900 (Eif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 109700900
NCBI-ProteinID: XP_020041871
Position
Unknown
AA seq 1367 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDSFVMRLKAARQSIYEEKLKQFE
QRLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRGEGRDEERLHRRDEDRPRRLGDDEERESSLRPDDDRIPRR
GLDDDRGPRRGPDEDRFSRRGADDDRPSWRNADDDRLPRRTDDERGSWRHGDDDRPPRRG
LDDDRGSWRAADEDRGPRRGMDEDRGPRRGGADDERSSWRNADDDRGPRRGMDDDRGPRR
GMDDDRGPRRGMDDDRIPRRGLDDDRGPWRSADDDRISRRGADDDRGPWRNMDDDRISRR
ADDDRIPRRSDDSRPAPWRPFVKPGGWREKEKAREESWGPPRETRPSEEREWDRDKDKDR
DNQDREENDKDPERERDRERDGDREDRFRRPRDEGGWRRGPAEESSSWRDSSRRDDRDRD
DRRRERDDRRDLRRDLRDDRDRRGPPLRSEREEASSWRRADDRKDDRAEERDPPRRAPPP
ALSRERDREREREGEKEKASWRTEKDRESLRRTKNETDEDGWTTVRR
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctattttcagaggccggaaaatgccctcaaacgcgccaacgaatttcttgag
gttggcaaaaagcaacctgctctggatgttctttatgatgttatgaaaagtaagaaacat
agaacatggcaaaagatacacgagccaattatgttgaaatacttggaactttgtgtggat
cttcgtaagagccacttggctaaggaaggattgtatcagtataagaacatttgccaacag
gtgaacattaaatctttagaggatgttgttagggcatatttaaaactagcagaggagaaa
accgaagctgctaaagaagaatcccaacagatggtattagatatagaagatctggataat
attcaaacccctgagagtgttctccttagtgctgtcagtggggaagatactcaggatcgt
actgacagattactgttaactccctgggttaagttcctgtgggaatcgtacagacagtgt
ttggaccttcttcgaaacaattctagagtagagcgcctttatcatgatattgcccagcaa
gctttcaaattctgcctccaatatacccgtaaggctgaattccgtaagctgtgtgacaat
ttgagaatgcacttatctcagattcagcgccaccataaccaaagtacagctatcaatctt
aataatccagagagtcagtccatgcatttggaaaccaggctcgttcagctggatagtgca
atcagcatggaactctggcaggaagcattcaaagctgtggaagatattcatgggctcttc
tccttgtctaagaaaccacctaaacctcagttgatggcaaattactataacaaagtctca
actgtgttttggaaatctggaaatgctctttttcatgcatctactctccatcgtctttat
catctttctagagaaatgagaaagaatcttacacaagatgagatgcaaagaatgtctact
agagtccttttggctacgctttccatccctatcactcctgagcgaactgatattgctcga
cttctggatatggatggcattattgttgagaaacagcgtcgccttgcaacactgctaggt
cttcaagccccaccaacacgaattggccttattaatgatatggtcagattcaacgtacta
cagtatgttgttccagaagtgaaagacctttacaactggctagaagtggaattcaaccca
ctaaaactctgtgagagagtcacaaaggttctaaattgggttagggaacaaccagaaaag
gaaccagagttacaacagtatgtgcctcaactgcaaaacaatactatacttcgccttcta
cagcaggtggcacagatttatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggctatagtagatgcagccagacactgtgacctg
caggttcgtattgaccacacttctcggactctgagttttggatctgatttgaattatgct
accagagaagatgcccccattggtcctcatctgcagagcatgccttcagaacagataaga
aatcagctcacagccatgtcctcagtgctggcaaaagcacttgaagtcatcaagccagct
catatactgcaagagaaagaagaacagcatcagttggcagttacagcataccttaaaaat
tcacgaaaagagcatcagcgtatcttagctcgccgtcagacaattgaggaaaggaaagag
aggcttgagagtctgaatattcagcgtgaaaaagaagaactggagcagagagaagctgag
ctccagaaagtacgaaaggctgaagaggagaggttgcgccaggaggcaaaggagagagag
aaggagcggatcttacaggaacacgaacaaattaaaaagaaaactgttcgagagcgtttg
gagcagatcaagaagacagaactgggtgccaaagcattcaaagatattgatattgaagac
cttgaagaattggatccagatttcatcatggctaaacaggttgaacaattagaaaaagaa
aagaaggaacttcaagaacgtcttaagaatcaagaaaagaagattgactattttgaaaga
gctaaacgtttggaagaaattcctttgataaaaagtgcttatgaggaacagaggattaaa
gacatggatctgtgggaacaacaagaagaagaaagaatcaccaccatgcagcttgaacgt
gagaaggctcttgaacacaagaatcgaatgtcaaggatgctggaagacagagattcattc
gtgatgcggctcaaagctgcccggcagtctatttatgaggaaaaacttaaacagtttgaa
cagcgattagcagaagaaaggcataatcgcttggaagaacggaagagacaacggaaggag
gaacgcagaataacatattatagagaaaaagaagaagaggagcagaggagggcagaagaa
caaatgctaaaagagcgagaagagagagagcgtgctgagcgagcaaaacgggaggaagag
cttcgagagtaccaggagcgggttaagaaactagaagaagtagaaaggaaaaaacgtcaa
agggagttggaaattgaagaaagagaacgtcgtagagaagaagagagaagactgggtgat
gacccactttctaggaaggactctcgttggggagatagagattcggaaggcacatggaga
aaaggtcctgaagctgattccgagtggagaagaggcccaccagaaaaggagtggagacgg
ggagaagggcgagatgaggagaggcttcataggagagatgaagatcggccaaggcgtttg
ggggatgatgaagagagagagtcttctcttaggccagatgatgatcgaatccctaggcgt
ggcctggatgatgacagaggccctcgacgtggacctgatgaagatcgcttctctcgtcgt
ggggctgatgatgatcgtccttcctggcgtaatgcagatgatgacaggctccccagacga
actgatgatgagagaggaagctggaggcatggggatgatgacaggcctcctagacgggga
ctggatgacgacagaggaagctggagagcagcggatgaggacagaggaccaagaaggggg
atggatgaggacaggggtccacgacgaggaggtgctgatgatgagcgatcatcctggcgt
aacgctgatgatgaccggggtcccaggcggggcatggatgacgaccggggtcccaggcgg
ggcatggatgacgaccggggtcccaggcgagggatggatgatgaccggattcccaggcga
gggttggatgatgaccgaggaccttggaggagtgctgatgatgacaggatctccaggcgt
ggtgcagatgacgacagaggcccttggagaaacatggatgatgatcgcatctctaggcgt
gctgatgatgatcggattcccagacggagtgatgactcaagacctgctccctggagacca
tttgtcaagccaggtggatggagagaaaaggaaaaagccagagaagagagttggggtcca
cctcgagaaacaagaccatcagaagaacgtgaatgggatagagacaaagacaaggataga
gacaatcaagatcgtgaggagaacgacaaggaccctgaacgagaaagggacagagaaaga
gatggggaccgtgaggatcgcttcaggagacccagggatgaaggtggctggagaagagga
cctgctgaggagtcttcaagctggagagattcaagtcgccgggatgacagggatagggat
gaccgccggcgtgagcgagatgatagacgtgatctacgacgggatctaagagatgacaga
gaccggaggggacctcccctgagatcagaacgagaagaagcaagctcttggagacgtgct
gatgaccggaaagatgaccgggcagaagagcgtgatccacctcgtcgtgcccctccccca
gctctttcacgagaaagagaccgagaacgagaaagggaaggtgaaaaagagaaggcctcc
tggagaaccgagaaagatagggaatctcttcgtcgtactaaaaatgagactgatgaagat
ggttggaccacagtacgacgttaa

DBGET integrated database retrieval system