KEGG   Castor canadensis (American beaver): 109701021Help
Entry
109701021         CDS       T04791                                 

Gene name
Crem
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109701021 (Crem)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccan03000]
    109701021 (Crem)
Transcription factors [BR:ccan03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109701021 (Crem)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5 Phage_Gp23 DUF4988
Motif
Other DBs
NCBI-GeneID: 109701021
NCBI-ProteinID: XP_020041968
Position
Unknown
AA seq 125 aa AA seqDB search
MQKPVMAVTGDETDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMATSPGSLHSPQ
QLAEEATRKRELRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLY
CHKAE
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagcccgtcatggctgtaactggtgatgaaacagatgaggaaactgaacttgcc
ccaagtcacatggctgctgccacaggtgacatgccaacttaccagatccgagctccaact
accgctttgccacagggggtagtgatggccacctcaccaggaagtttgcacagtccccag
caactagccgaagaagcaacacgtaaacgggagctgaggctaatgaaaaacagggaagct
gcccgggagtgtcgcaggaagaagaaagaatatgtcaaatgtcttgaaaatcgtgtggcc
gtgcttgaaaaccaaaacaagaccctcattgaggaactcaaggccctcaaagatctttat
tgccataaagcagagtaa

DBGET integrated database retrieval system