KEGG   Castor canadensis (American beaver): 109701091Help
Entry
109701091         CDS       T04791                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: arylamine N-acetyltransferase 1-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00232  Caffeine metabolism
ccan00983  Drug metabolism - other enzymes
ccan01100  Metabolic pathways
ccan05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    109701091
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109701091
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    109701091
Enzymes [BR:ccan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     109701091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 109701091
NCBI-ProteinID: XP_020042077
Position
Unknown
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSRNKLDLETLTNILQHQIRAVPFENLNIHCGESIDMGLEATFDQVV
KRRRGGXCLQVNHXLNWALTTMGFETTMLGGYVYIPPARKYSSDMIHLLLQVTIGGRNYI
VDAGYGGSYQMWEPLELISGKNQPQVPSIFRLTEEKGIWYLDQIRREQYIPNEEFSNSDF
LEKSKYRKIYCFTLQSQAIEDFEFVNTYLQTSPTSGFTNISYCSLQTPEGVYCLVGSTLA
YRQFSYKDNVDLVEVNTLSEEEIEEVLKTIFNISLEIKYIPKHGDKSFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacatagaagcatattttgaaagaattggttataagaattctaggaacaaattggac
ctggaaacattaaccaacattcttcagcatcagatccgagctgttccctttgagaacctg
aacatccattgtggtgaatccatagatatgggcttggaggccacttttgatcaagttgtt
aagagaaggcggggtgggtgatgtctccaggttaatcacnctctcaactgggctctgacc
acaatgggttttgagaccacaatgttggggggatatgtttacatccctccagccagaaaa
tacagcagtgacatgattcacctactattgcaggtaacaattggtggcaggaactacatt
gtggatgcagggtatggaggctcctaccagatgtgggagcctctggaattgatttctggg
aagaatcagcctcaggtaccttccatcttccgattgacagaagagaaaggaatctggtac
ctggaccaaatcagaagagagcagtacattccaaacgaggaattttctaattctgacttt
ctggagaagagtaaataccgaaaaatctactgctttactcttcaatctcaagcaattgaa
gattttgaatttgtgaatacataccttcagacatccccaacatctgggtttacaaatata
tcttattgttccttgcagaccccagaaggggtttactgtttagtgggctccacccttgcc
tataggcaattcagttataaggacaatgtagatctggtagaggttaacactctgagtgag
gaagaaatagaagaagtactgaaaactatatttaatatttccttggaaataaaatatatt
cccaagcatggtgacaaatcctttactatttag

DBGET integrated database retrieval system