KEGG   Clavibacter michiganensis subsp. capsici: AES38_02050Help
Entry
AES38_02050       CDS       T05227                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ccap  Clavibacter michiganensis subsp. capsici
Pathway
ccap00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ccap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AES38_02050
Enzymes [BR:ccap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AES38_02050
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AES38_02050
    1.1.1.-  
     AES38_02050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_2 IGFBP Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALD11887
UniProt: A0A0M4GYL9
Position
411517..412581
Genome map
AA seq 354 aa AA seqDB search
MIRIDPSPISARYAVVDGDRSLAFHEEEVGAPEPHQVVVRIRYTGVCATDTHAWAADGFV
PAAVFGHEWTGTVVRAGADVTSVAEGDRVVAGVGPACGTCAMCRAGHGDTCDTAFAEANG
ISEGAPAHGAFATHVTVSARRVVRALDGLTDEQLGLVEPTAVTFHAVRRAGQALGDVVVV
QGAGPIGLLTAQHARHAGAGVVLVVEPSEPRRRAAADLGFAEVHEPGQAFRDRLLELSDG
LGADVLYECTGAAALLQPSAELVRRGGTLALLGYPMSASEVSYGDWQSRELTVVGSLAYS
HSDFVGAMRALADGSVDVGPLVTGILSLDELPALLAELDGGTTRHAKALIEPGR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatcgacccctccccgatctccgcccgctacgccgtcgtcgacggcgaccgc
tccctcgccttccacgaggaggaggtgggggcgcccgagccccaccaggtcgtcgtccgg
atccgctacacgggcgtctgcgcgaccgacacccacgcctgggctgccgacggcttcgtc
cccgccgccgtcttcggccacgagtggaccggcacggtcgtccgcgcgggcgccgacgtg
acctccgtggccgagggcgaccgcgtcgtcgccggcgtgggccccgcatgcggcacgtgc
gccatgtgccgcgccggccacggcgacacctgcgacacggccttcgcggaggccaacggg
atctccgagggcgcgcccgcgcacggcgcgttcgccacccacgtcacggtctccgcgcgc
cgcgtcgtgcgcgccctcgacggcctcacggacgagcagctcggcctcgtggagccgacc
gccgtcaccttccacgccgtccgccgcgcgggccaggccctcggcgacgtcgtcgtcgtg
cagggcgccgggccgatcgggctgctcaccgcccagcacgcgcgccacgcgggcgcgggc
gtcgtcctggtcgtcgagccgtccgagccgcgtcgccgcgccgcggccgacctcgggttc
gcggaggtccacgagcccggccaggccttccgcgaccgcctcctcgagctcagcgacggc
ctcggcgccgacgtgctctacgagtgcaccggcgccgccgcgctcctccagccgagcgcc
gagctggtgcgccgcggcggcaccctggcgctgctcggctatcccatgtccgcgtccgag
gtgtcctacggcgactggcagagccgcgagctcacggtcgtcgggtccctcgcgtactcc
cacagcgacttcgtcggagccatgcgcgccctggccgacggctccgtcgacgtcgggccg
ctcgtgaccgggatcctctccctcgacgagctgccggccctcctcgccgagctcgacggc
ggcaccacgcggcacgccaaggcgctcatcgagcccggtcgctga

DBGET integrated database retrieval system