KEGG   Clavibacter michiganensis subsp. capsici: AES38_08935Help
Entry
AES38_08935       CDS       T05227                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ccap  Clavibacter michiganensis subsp. capsici
Brite
KEGG Orthology (KO) [BR:ccap00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ccap03009]
    AES38_08935
Enzymes [BR:ccap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     AES38_08935
Ribosome biogenesis [BR:ccap03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AES38_08935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 ADH_zinc_N Methyltransf_12 Methyltransf_31 HAD Ubie_methyltran MetW MTS DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: ALD13025
UniProt: A0A0M3RRB7
Position
1899991..1900878
Genome map
AA seq 295 aa AA seqDB search
MDLARLASWLRCPVCGDELEADPPLVLRCGRGHAVDANKRGYATLLAPGTRVVGDTAEML
TARGRFLDRGHYQPLVDALLEALGHGASEPPARRILDAGCGTGHYLRAVLDHQTGSTGLA
ADLSPAAVAIAVRGRPDVDGVVADTWAALPLRDGVADLVLDVFAPRNLPEFHRVLAPGGR
VAVVAAGPEHLAELRASGRAVGVQEDKRERILEAADPYFEAVAETRVQRVLRLTDDDIAL
LLGMGPSAHHTGGQHVTAVTTEPGVEADATAGNTQEVTIDVMIHVLRRRGTAPSS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggatctcgcccggctcgcgtcgtggctccgctgtcccgtgtgcggcgacgagctggag
gccgatcccccgctcgtgctccgctgcggccgcggccacgccgtcgacgcgaacaagcgc
gggtacgccacgctgctggcgcccgggacgcgcgtcgtcggggacacggccgagatgctc
accgcccgcggccggttcctggaccgcgggcactaccagccgctcgtcgacgccctgctc
gaggccctcggacacggcgcgtccgagccgccggcccggcgcatcctggacgccggctgc
ggcacgggccactacctgcgcgccgtcctcgatcaccagaccgggtcgacggggctcgcc
gcggacctctcccccgcggccgtcgcgatcgccgtccgcggtcgccccgacgtcgacggg
gtcgtcgcggacacctgggcagcgctccccctgcgcgacggcgtcgccgacctggtcctc
gacgtcttcgccccgcggaacctgccggagttccaccgcgtgctcgccccgggcgggcgg
gtggccgtggtcgccgcgggccccgagcacctcgccgagctgcgggcctccggacgggct
gtgggcgtgcaggaggacaagcgggagcggatcctcgaggccgccgatccgtacttcgag
gcggtcgccgagacgcgcgtccagcgggtcctgcgcctgaccgacgacgacatcgccctc
ctgctgggaatgggcccgtccgcccatcacacgggcggccagcacgtgaccgccgtcacg
acggagcctggcgtggaggccgacgcgacggcggggaacacccaggaggtcacgatcgac
gtcatgatccacgtgctgcgtcgacgcgggaccgcgccgtcctcctga

DBGET integrated database retrieval system