KEGG   Clavibacter michiganensis subsp. capsici: AES38_12625Help
Entry
AES38_12625       CDS       T05227                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ccap  Clavibacter michiganensis subsp. capsici
Pathway
ccap03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ccap00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AES38_12625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ccap03011]
    AES38_12625
Ribosome [BR:ccap03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AES38_12625
  Bacteria
    AES38_12625
  Archaea
    AES38_12625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALD13643
UniProt: A0A0M4H8G0
Position
complement(2693938..2694330)
Genome map
AA seq 130 aa AA seqDB search
MVESIARVRHIRVTPQKARRVVDMIRGKQAEEALAILKFAPQGASEPIYKLVASAMANAR
VKADASNSFLSEQDLYIAKAFVDEGTTLKRFQPRAQGRAFRINKRTSHITVVLATPDEAD
VASTTKKASK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgcgtgcgtcacatccgcgtcaccccccagaaggcccgccgt
gtcgtcgacatgatccgcgggaagcaggccgaggaggccctcgccatcctgaagttcgcc
ccccagggcgcgagcgagccgatctacaagctggtggcctcggccatggcgaacgcgcgg
gtcaaggccgacgcgtcgaacagcttcctctcggagcaggacctctacatcgccaaggcg
ttcgtggacgagggcaccaccctcaagcggttccagccgcgcgcacagggtcgcgcgttc
cgtatcaacaagcgcaccagccacatcacggtcgtcctcgcgacgccggacgaggcggac
gtggcgtcgaccacgaagaaggcgagcaagtaa

DBGET integrated database retrieval system