KEGG   Cyprinus carpio (common carp): 109044823
Entry
109044823         CDS       T05134                                 

Gene name
clock
Definition
(RefSeq) circadian locomoter output cycles protein kaput
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109044823 (clock)
   03036 Chromosome and associated proteins [BR:ccar03036]
    109044823 (clock)
Enzymes [BR:ccar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109044823 (clock)
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109044823 (clock)
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109044823 (clock)
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 DUF1664 OmpH
Other DBs
NCBI-GeneID: 109044823
NCBI-ProteinID: XP_018918301
Position
40
AA seq 761 aa
MTSSIDRDDSSIFDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMD
KSTILQKSIDFLRKHKEIAAQSESSEIRQDWKPPFLSNEEFTQLMLEALDGFFLAIMTDG
NIIYVSESVTSLLEHLPSDLVDQNLLNFLPLGEHSEVYKALSTHILEGETLTPDYLKTKN
QLEFCCHMLRGTIDPKEPPVYEYVKFIGNFKSLNTVPNSTRNGFEGVIQRSLRPMFEDRV
CFIATVRLAKPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLETLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFI
VCTHTVVSYAEVRAEQRRELGIEESPPEISADKSQDSGSESQLNTSSLKEALERFDHSRT
PSASSRSSRKSSSHTAVSDPTSTQTKLQTDHSTPPRQSVSAIEMTSQRRSSISSQSMSSQ
NTGQTMAASLVSQPQQPQPLQPSVQPVLQFSAQMDAMQHLKDQLEQRTRMIEANIQRQQE
ELRQIQEELQRVQGQGLQMFLQPGGGGLNLGSVQLTQGSSVQQGGALSMQGAVVPAGSLQ
SGLQSTHTATQHTVTQHPQQAPPQQQNLLRDQSSTLTQQSQRSSHTLQSPQGALPASLYN
TMMISQPAQANVVQISTSLAQNSSPSGAAVATFAQDRQIRFPAAPQLLTKLVTGPMACGA
VMVPTTMFMGQVVTAFAPQQGQAQTISITQQPSAQTPEQVP
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgacctctagcatagaccgggatgacagcagtatctttgatgggttgatggaagaagat
gagaaggacaaagcaaaaagagtttctaggaacaagtctgagaagaagaggcgagaccag
ttcaatgtgctcatcaaggaactgggcaccatgctgccgggcaacacccgcaagatggac
aagtctaccatcctacagaagagcatcgacttcctgcgcaagcacaaagaaattgctgca
cagtccgagtcgagtgaaatccgtcaggactggaagccgcctttccttagcaatgaagag
ttcacacagctgatgctggaggctctagatggcttctttttagccatcatgacagacgga
aacataatctacgtctcagaaagtgtcacgtctttattagaacatctaccttctgatctt
gtggatcagaatctgttgaattttcttccactgggtgagcactcagaggtgtataaagct
ctatccacacacatactggagggagagaccctcaccccagactacctaaaaacaaagaac
cagttagagttctgttgccacatgctccggggcacgatcgacccaaaagagccgcccgtt
tatgagtatgtcaagttcatcggaaactttaagtccctcaacactgtgcctaactcaaca
cgtaacggctttgagggagtgatccagcgatcgctgaggcccatgtttgaagaccgagtg
tgtttcatagcaactgtgaggttagccaagcctcagtttatcaaggaaatgtgtactgtg
gaggagcccaatgaggaattcacctccagacacagtttagagtggaaattcctcttcttg
gaccacagggcaccccccatcataggctacctacccttcgaggttctgggtacttcaggg
tacgactactatcatgtggatgacctggagactctggccaagtgccatgaacacttgatg
cagtatggtaaggggaagtcgtgctattaccgtttcctgactaaaggtcagcagtggatc
tggcttcagactcactactatatcacctaccaccagtggaactcacggccggagttcatc
gtctgcacacacactgtggtcagctatgctgaagtgagggctgaacagcgcagggaactg
ggcattgaggaatcacctcctgagatctcagcagacaagtctcaggactccggctctgag
tcccagttgaacacctccagtctgaaggaggcgctagagcgattcgatcacagccgcaca
ccctccgcctcctcacggagctcccgcaaatcctcctcacacaccgctgtctcggacccc
acttccacacagacaaagctacagacagaccatagcacacccccccgccaatcagtgtca
gccattgagatgacatcacagcggaggtcctccattagcagtcagtcgatgagttctcag
aacacaggacagacgatggcagcatctcttgtgtctcagcctcagcagcctcagccactt
cagcccagtgtgcagccggtgctgcagttttctgcacagatggacgcgatgcagcatctt
aaggatcaactggaacagcgcacacgcatgattgaggccaacattcagagacaacaagag
gaactgcggcaaatccaggaggagctgcagagggtgcaaggccagggcttacagatgttc
ttgcagcccggaggtggtggtctcaacctcggctcagtgcagctgacgcagggatcatcc
gtgcagcaagggggcgctctgtccatgcagggggcggtggtgccagcaggaagcctgcaa
agcggcctgcaatccacacacacagcgacacaacacactgtcacacagcatcctcagcag
gcaccgccacaacaacagaaccttctcagagatcagagctccactctaactcagcagtct
cagaggtcgtctcacacattgcagtctcctcagggagcactgcctgcatctttgtataat
accatgatgatctctcagccggcgcaggccaacgttgtccagatctccacaagcttggcc
cagaacagcagccccagcggagctgcggtcgccaccttcgcacaagaccggcagatacgg
ttccctgctgccccacagctcctcaccaagctagtaaccggcccaatggcgtgtggtgca
gttatggtgcctaccaccatgttcatggggcaggtggtgactgcgtttgctccgcagcag
ggccaggctcaaacaatcagcatcacccagcagccgtctgcgcagacgccggagcaggtg
ccg

DBGET integrated database retrieval system