KEGG   Cyprinus carpio (common carp): 109044911Help
Entry
109044911         CDS       T05134                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 16 homolog
  KO
K20180  vacuolar protein sorting-associated protein 16
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109044911
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109044911
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    109044911
   Hops complex
    109044911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vps16_N
Motif
Other DBs
NCBI-GeneID: 109044911
NCBI-ProteinID: XP_018918366
Position
40
AA seq 500 aa AA seqDB search
MAFVTANWNPLGESFYRKIELYEMGWNLKDGLRECLVAAAPYGGPIALLKGHYRRSPSAR
PQLEIYSSSGLPLASFPWKSGVVKQLGWTVSDDLLCVQEDGTVLVYDLWGGFKRHFSMGN
EVSQSQVLETKIFHSPYGTGVAILTGALRFTLATNIDDIKLRRLPEVPGLQEAPSCWAVL
TQDRQSKVLVANGSQLFILDNTACTPVTPPGLSPQASSIVHMCVSFSYKYLALLTDSGHV
WMGTSNLKEKLSEVDTKIKTPPKQMAWCRRPKSQQPSAVVMWDGLLIVVGECKETIQYHL
DDDSVLVPELDGVRIISGTHHELLQEVPGACEEIFKIASMAPGALLLEAHKEYEKESQKA
DEYLREIKEQSLLSEAVRQCVEAAGHEHEPETQKTLLRAASFGKCFLSNFPPEQFVSMCR
DLRVLNAVRDYTVGIPLTHTQFKQMTVQVLIDRLVYRKLYPLAIEVCRYLKTPEYQGVSR
VLKHWACYKALSDIQDVVDR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgtcacagcgaactggaaccctctgggcgagtctttttacagaaagattgaa
ttgtatgagatgggctggaatctgaaagatggcctgagagagtgtctggttgctgcggct
ccatatgggggtcccatcgctctcctaaagggccattaccgacgctctcccagtgccaga
cctcagttagagatctactcttcctcaggactgcctctggccagttttccatggaagagt
ggagtggtgaagcagctgggttggacggtgtctgatgacctgctgtgtgttcaggaggat
ggcactgtgcttgtctacgatctctggggtggcttcaagagacacttcagcatgggcaat
gaagtttctcagagtcaggttctggagaccaagattttccattcgccatatgggacaggg
gttgccatactgacaggtgccttgcgattcactttggccacaaatattgatgacataaaa
ttgaggcggttgcctgaggttccaggtctacaggaggcaccctcatgctgggcagtcctg
actcaggacagacaaagtaaagtgctggtggccaatggatctcaactgttcatcttagac
aatacagcctgcacacctgtgactccaccaggtctctctccacaagcgtccagcatagtt
cacatgtgtgtctcattcagttataagtatctggcgctcctcactgactctggccatgtg
tggatgggcacatcgaacctaaaggagaaactcagtgaggtggacaccaaaatcaaaact
ccccctaaacagatggcctggtgtcgcaggcccaagagtcagcagccatcagctgtggta
atgtgggatgggctcctcatagtggtgggagagtgtaaagaaacaattcagtaccacctg
gatgatgactcagttctggtgccggagctggacggggttcggatcatcagtggaacacac
catgagcttctgcaagaggtcccaggtgcatgtgaggagatctttaaaattgcctcaatg
gctcctggagcattacttctggaggctcataaagaatatgaaaaagagagtcagaaggca
gatgagtatctgagagagattaaagagcagagtctgttgagcgaggctgtgaggcagtgt
gtggaggcagccggacatgaacatgaacctgagacacagaaaacactcttgagggcagcc
tcatttgggaagtgctttttgagtaattttcctccagagcagtttgtcagcatgtgcaga
gacctgcgggtgttgaatgcagtccgagactataccgttggcattcctctcacccacact
cagttcaaacagatgactgtgcaggtgctcattgacagactggtgtatcgtaaactctat
ccactggctattgaggtttgccgctatttaaagactccagaatatcagggagtgagccga
gtactcaaacactgggcctgctacaaggcactatctgacattcaggatgtagtcgacaga
taa

DBGET integrated database retrieval system