KEGG   Cyprinus carpio (common carp): 109046439
Entry
109046439         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: acid-sensing ion channel 1-like
  KO
K04829  acid-sensing ion channel 1
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccar04040]
    109046439
Ion channels [BR:ccar04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   109046439
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 109046439
NCBI-ProteinID: XP_018919728
Position
43
AA seq 556 aa
MVRITCTISFSTDDEPVGRSRQGSIDDHYKRVVWSRDGEHGKYQEDGDDPDTCDGTEDEE
VPDISLATFFGGCSLHGANHVFVDKKFSVRQGLWATVFLLAISMFLMQVVDRVIYYLQYD
YITLLDERNARNMTFPAITLCNYNSFRRSQMSYSDLLFMGPMLGYEDNMAPGIPLAPEPD
RQGSRFSLAEFFNRTRHRMEDMLLECKFSGKECAPEHWREIFTRYGKCYTFNSGQDGRPL
LITMMGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLGFGVA
PGFQTFVSCQEQRLTYLPPPWGDCKATAMDSDFSSTYSITACRIDCETRYLVENCNCRMV
HMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNMTRYGKELSFVKIPSKASAK
YLAKKYNKTEQYIAENILVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIGASIL
TILELFDYLYEVIKFKLCRCAKKKHQRSSNNDRGAVLSLDDVKRHAPCDNLHTPSTYPAN
MLPHHPGQGNFEDFTC
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggtacgaatcacatgcaccatctccttcagcacagatgatgagccagttggccgctcg
cgccaaggcagcatcgatgaccactacaagcgcgtggtgtggtcaagagatggcgaacac
ggcaagtaccaggaggatggtgacgatccggacacatgtgatgggacggaagacgaagaa
gtgcccgacatcagccttgccacgttttttggcggctgctccctccacggcgccaaccac
gtctttgtggacaagaagtttagtgtccgccagggcttgtgggccacggtctttctattg
gcgatctctatgttcctcatgcaggtggtggaccgtgtcatctactacctgcagtatgac
tacatcaccttgctggacgagcgcaatgccaggaacatgacgttcccggccatcacgctc
tgcaattacaactcgttccggcgctcgcagatgagctacagcgacctgctcttcatgggg
ccaatgttgggatacgaggacaacatggctccgggaatccctttggcgccggagcccgac
aggcaaggctctcgattcagcctggccgagttcttcaatcgcacccgtcaccgcatggaa
gatatgctgctagagtgcaaattctctgggaaggagtgtgcgccggaacactggagagag
atcttcacccgctatggaaaatgctacaccttcaattctggacaggacggacggccactg
ctgatcaccatgatgggagggatgggaaatgggctggagctgatgctggatatccagcag
gatgagtatctgcctgtgtggggagagacagatgagacgtctttcgaagcgggaatcaaa
gtccagatccacacgcaggatgaaccgcctttcatcgatcagctgggatttggagtggct
ccaggcttccagacgttcgtctcctgccaagaacagcggctgacatatcttcctcctcca
tggggtgactgtaaggcaacagcaatggactctgatttttccagcacatacagtatcact
gcctgccgcatcgactgtgagacacgctatctggtggagaactgcaactgccgcatggtg
cacatgcctggagacgctccatattgcactccagaacagtataaggaatgtgcagatccc
gctctagattttctggtggagagagacaatgactactgcgtttgcgagacgccctgcaac
atgacacgctacggcaaagagctgtccttcgtcaagatccccagcaaagcctctgccaaa
tacctggccaagaagtacaacaagacggagcaatacatcgcagaaaacatcctggtgctg
gacatctttttcgaggccctgaactacgagaccatcgagcagaagaaagcctacgagtta
gccggccttctcggtgacattggcggacagatggggctgttcatcggggccagtatctta
accatcctggagctctttgactatctgtatgaggtgatcaagttcaaactgtgtcgctgt
gccaaaaagaaacaccagcggagcagcaacaacgatcgaggagccgttctcagcctggat
gacgtgaagcgtcacgctccctgtgacaaccttcataccccgtcaacctacccagccaac
atgctacctcaccatcctggccagggcaacttcgaagacttcacctgttga

DBGET integrated database retrieval system