KEGG   Cyprinus carpio (common carp): 109046666Help
Entry
109046666         CDS       T05134                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04060  Cytokine-cytokine receptor interaction
ccar04068  FoxO signaling pathway
ccar04110  Cell cycle
ccar04218  Cellular senescence
ccar04350  TGF-beta signaling pathway
ccar04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109046666
   04350 TGF-beta signaling pathway
    109046666
   04068 FoxO signaling pathway
    109046666
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109046666
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109046666
   04218 Cellular senescence
    109046666
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109046666
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109046666
   00536 Glycosaminoglycan binding proteins [BR:ccar00536]
    109046666
Cytokines and growth factors [BR:ccar04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109046666
Glycosaminoglycan binding proteins [BR:ccar00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   109046666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 109046666
NCBI-ProteinID: XP_018919984
Position
43
AA seq 93 aa AA seqDB search
MEKNASNLVKAELRIFRLQNPKARVSEQRIELYQILGHKDLTSPTQRYIGSKVVRTRTEG
EWLSFDVTEAVSEWLLHRGKVLLGSPKRKINDF
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaatgcctcgaacctggtgaaggcagagctcaggatcttcaggctgcagaac
ccaaaggcccgtgtgtctgagcagcgcatcgagctttaccagattttaggtcacaaggac
ctcacgtcccccacacagcgctacattggcagcaaggtggtgcgcacccgcacggaggga
gagtggctgtcgttcgacgtgacggaggctgtcagtgagtggctgctgcacagaggtaaa
gtcctgctgggaagtccaaaacggaagattaatgacttttag

DBGET integrated database retrieval system