KEGG   Cyprinus carpio (common carp): 109047937Help
Entry
109047937         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: isotocin receptor-like
  KO
K04229  oxytocin receptor
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04020  Calcium signaling pathway
ccar04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    109047937
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109047937
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ccar04030]
    109047937
G protein-coupled receptors [BR:ccar04030]
 Rhodopsin family
  Peptide
   Oxytocin
    109047937
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Gaa1
Motif
Other DBs
NCBI-GeneID: 109047937
NCBI-ProteinID: XP_018921145
Position
45
AA seq 390 aa AA seqDB search
MEDILKDQDFWSFNESSRNSSVNNETYGVNQTVNPLKRNEEVAKVEVTVLALVLFLALTG
NLCVLVAIHTAKHSQSRMYYFMKHLSIADLVVAVFQVLPQLIWDITFRFYGPDILCRLVK
YLQIVGMFASTYMLVLMSIDRCMAICQPLRSLHKRKDRCYVICSWALSLLFSIPQVYIFS
LREVGSGVYDCWGDFVQPWGAKAYITWISLTIYIIPVAILSVCYGLISFKIWQNFKRKTK
KDQCITLTPKASKGSTLTRVSSVKLISKAKITTVKMTFVIVLAYIVCWTPXFSVQMWSAW
DPXAPREAMPFIISMLLASLNSCCNPWIYMFFAGHLFHDLKQNLLCCSTLYLKSSQCRCD
PEQDSRKSNSSTYVIKSTSSQRSITQTSVT
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggaggacatcttaaaggatcaagacttctggtccttcaatgagtcatctagaaactcc
agcgtcaacaatgaaacttacggagtgaaccagacggtgaacccgctgaagcggaatgaa
gaggtggcaaaagtggaagtcactgtattggccttggtgctcttcttggcactcactggt
aacctttgtgtccttgttgcaatccacacggccaagcacagtcaatctcgcatgtactac
ttcatgaagcacctcagcattgcagatctggtcgtggctgtcttccaggtacttcctcaa
ctcatctgggacataacatttcgcttttatggaccagacatcctgtgcaggttggtgaaa
tatcttcagattgttgggatgttcgcctccacgtacatgctggtgctgatgtccatagac
agatgtatggcaatctgccagccccttcgttctttacacaagcgaaaggaccgctgttat
gtgatttgttcttgggcactaagcttacttttcagcatcccacaggtttatatattttcc
ttacgggaggtgggttcaggagtatatgattgctggggagatttcgtgcagccgtgggga
gcgaaggcatacattacatggattagtctgacaatatacatcataccagtggccattctg
agcgtctgctacggactgataagttttaaaatatggcaaaactttaaaaggaagacgaag
aaggaccagtgtatcactctcacacccaaggcatcgaaaggcagcacactcacgcgggtc
agcagtgtcaaactcatctccaaggccaaaatcaccactgttaaaatgacctttgttatc
gtactggcttatatagtgtgctggactccgnttttctccgtacagatgtggtcagcatgg
gatcctngagcaccaagggaagcaatgcccttcatcatttccatgttgctggccagtctg
aacagctgctgtaacccctggatctacatgttttttgctgggcatcttttccatgacctg
aagcagaacctgctgtgctgttccactctctatctgaagtcctctcagtgccggtgtgat
ccggagcaggattcccgtaagagcaactcctccacctacgtcatcaaaagtaccagcagc
cagcgaagtatcacccagacctctgtcacataa

DBGET integrated database retrieval system