KEGG   Cyprinus carpio (common carp): 109048374
Entry
109048374         CDS       T05134                                 

Definition
(RefSeq) neuronal PAS domain-containing protein 3-like
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109048374
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    109048374
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS_9 PAS PAS_4
Other DBs
NCBI-GeneID: 109048374
NCBI-ProteinID: XP_018921604
Position
45
AA seq 532 aa
MPRHHMALNLVPSPTSFTISPKYSVPFNSETSTNHTVELTGSSVFDYVHPGDHVEMAEQL
GMKLPPGRGLLSQGGGAEDGGSSASSSSHSETPEPAHLAEYCACNTKVKGLISRSLDGQA
VCSSSASSSSHSETPEPVESNSPSLLSPDNILERSFFIRMKSTLTKRGVHIKSSGYKVIH
ITGRLRIRMALTHSRSVPNQIMGMVVMAHALPPPTINEVRIDCQMFVTRVNMDLNIVYCE
NRISDYMDLTPVDIVGKRCYHFIHAEDVEGIRQSHLDLMNKGQCVTKYYRWIQKNGGYIW
IQSSATIAINAKNGNEKNIIWVNYVLSNPEYKDTPMDIAQLPNLPGKASESSETSDSESD
SKENSEDNENSKSDGKGNQSSENSEDPESDSKKQMGQPPEQEMRRQEEGDSSSNPESQDS
DDSLEPSDCETDNKEGRLGGLHIKVEHYGDGEVEELQDSPSSFSSSEEEEDEVEDIVKDC
NSGGELSGPAMSKHQKRRRGEKTEMGWKSTTSLSVSLGCCYPQPWQPGPHPW
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgcctcggcatcacatggcactaaacttggtcccatcacccacctccttcaccatcagc
cccaaatacagtgtcccattcaacagcgaaacctctaccaatcataccgtagagctgacg
ggcagcagtgtgttcgattacgttcacccgggggatcatgtggagatggccgagcagctg
ggcatgaagcttccaccgggcagagggctgctgtctcagggcggcggggccgaggatggg
ggcagctctgcctcttcttcctctcactctgagacacctgagccagctcacttggcagaa
tattgcgcttgcaacaccaaagtcaagggtttgattagcaggagtctggacgggcaggca
gtgtgttcgagctctgcctcttcttcctctcactctgagacacctgagccagtggagtcg
aacagccctagtcttctgtcaccggataacattctagaacgctccttcttcattcgtatg
aagtccacgctcaccaagagaggcgtccacatcaagtcctctggatacaaggttatccac
attaccggcaggctgcggataagaatggcattaacacacagtcgttcggtacccaatcaa
atcatgggcatggttgtgatggcacacgcacttcctccgccaaccatcaatgaggtccgg
attgactgccagatgtttgttacacgggtcaacatggatctcaacattgtttactgtgaa
aacagaatcagtgactacatggacctgacacctgtcgacatcgtagggaagagatgttat
cacttcattcacgcagaggacgtggaaggcattcggcaaagccatttagacctgatgaat
aaaggtcagtgtgtgacaaaatattaccgctggattcagaagaatggaggttatatctgg
atccagtccagtgccactattgcaatcaacgccaagaatggcaacgaaaaaaacatcatc
tgggtcaactatgtactcagtaatccagagtacaaagatacacccatggatattgcacag
ctgcctaacctgccagggaaagcatcagagtcctcagaaacatctgattctgaatccgac
tccaaggagaactctgaagacaatgaaaactccaagtcagatggaaaagggaatcagtct
tctgagaacagtgaagatccagagtcggacagtaagaaacagatgggccagccgccagag
caagaaatgagacgacaggaggaaggagacagttccagcaatccagaaagtcaggacagt
gatgatagtctggaaccttctgactgtgaaaccgacaacaaggagggccgcctagggggt
ttacacataaaggtggagcattatggtgatggtgaggtggaggaactacaggactcgccc
tcctctttctcctcctcagaagaagaggaggatgaggtggaagatattgtgaaggactgc
aacagtggaggagagctgagcggaccagcaatgagtaaacaccagaagagaagaagagga
gaaaaaacagaaatgggatggaagtcgacaacgtctctgtctgtctccctcggctgctgc
tacccccagccctggcagcctggaccccacccttggtga

DBGET integrated database retrieval system