KEGG   Cyprinus carpio (common carp): 109048454
Entry
109048454         CDS       T05134                                 

Gene name
c5h9orf3
Definition
(RefSeq) aminopeptidase O
  KO
K09606  aminopeptidase O [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109048454 (c5h9orf3)
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109048454 (c5h9orf3)
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109048454 (c5h9orf3)
SSDB
Motif
Pfam: Peptidase_M1 Peptidase_M1_N
Other DBs
NCBI-GeneID: 109048454
NCBI-ProteinID: XP_018921672
Position
5
AA seq 635 aa
MESNRDLDLDPNKDDLPLRANTNHMLVRHYVLDLTVHFQRKVIGGSIVLFLEPGVVSSKQ
GEAGSISNTPVQNLSQVSSKHDVSSPITPEPNKVRPPEEPSHLCGGNDVSSVLWGDESED
FTLVLDCCDLMVSKVEELDVTTVDDLKKLDVDQQHANTDHPSSSLIQRLVSMPSVCWRLQ
HELYVQCSRSPTVHNAQPLRFHTDRWSLQIRKEGVCAPHDFPRAVRICYETKLTGGSVRW
TKDQDGRCCVYTMGSPINNRALFPCQEPPVAMSTWQARVRAPCDYTVLMSGENQAFPKPA
ETGFLQWEYYVTMPMPASTFTIAVGQWLEAGVKHPNFEVEKTDKPLDNDDQQYVCSHMDY
PCRFMVSAARAQAVIPHRVFAPPCHLQKANDMVLPLLPLCLTAAHSVLGVHPFSRLDVLI
VPSGFSSLGMASPHIVFLSQSVLTGERNLCGARLCHEIAHSWFGLAIGARDWTEEWISEG
FATYLEDVFWSHVQKLGCREAEEQRRLKALLRWRRLSDELQNSEEELQVLRPNKENTGEV
SESGASVVKHALNPEKPFMQVHYLKGYFLLKFLADQVGEEKFLDFFKVFVGKFHGQLILS
QDFLQTLLDTFPGMSRYNGMVLTLAVQNTCSLVAH
NT seq 1908 nt   +upstreamnt  +downstreamnt
atggaaagtaaccgcgatctggatctggatcccaataaagatgacctgcccctgcgggct
aacaccaaccatatgctcgtccgacactatgttcttgacctgactgttcacttccaaagg
aaggtcattggtggaagcattgttctgtttctggagcccggtgtggtttccagcaaacaa
ggtgaagcagggtctatatcaaacacaccagtgcaaaacctatctcaggtgtcatctaaa
catgacgtaagttctcccatcacacctgagccaaataaggtgagaccccctgaggaacca
tcacatttgtgtggaggaaatgatgtcagtagtgtcttgtggggtgatgagagtgaagat
ttcaccttagtgctggattgctgtgacctgatggtgtcaaaagtggaagagttggatgta
actacagtagatgatttaaagaagctcgacgtagaccaacaacatgcaaatacagatcat
ccttcatccagtctgatacaaaggctggtctctatgccttccgtctgctggagactgcag
catgagctatacgtccagtgcagccgttctcctactgtccataatgcccaacctctacgg
ttccacacagaccggtggagtcttcagatcaggaaggaaggggtttgtgcccctcatgat
ttcccacgtgctgtcagaatatgctatgaaactaagctcacaggtggttctgtgaggtgg
acgaaagaccaggatggcagatgctgtgtatataccatgggctcgcccatcaacaacaga
gccctcttcccgtgccaggagccacctgttgccatgtcaacgtggcaggcgcgtgtgaga
gctccgtgtgattacactgttctaatgagtggggaaaatcaagccttccctaagcctgca
gagacaggttttctgcagtgggaatattatgttacaatgccaatgccagcctctaccttt
accatagcggtggggcaatggctagaggctggagtaaaacatcccaactttgaggtggaa
aaaacggacaaacctttggacaatgatgatcagcaatatgtttgctcccacatggattat
ccgtgtcgcttcatggtcagtgctgccagggctcaggctgttattcctcaccgggtattc
gccccaccctgccacctgcagaaggcaaatgacatggttttacccctactgcctctctgt
ctgactgcggcccactctgttcttggtgtccatccattctcacgtctagatgtgctcatt
gttccctcagggttctccagtctgggcatggccagtccacatatcgtgttcctgtctcaa
agcgtgctaacgggtgagaggaatctctgtggggcaagattgtgccatgaaattgctcat
tcttggtttgggttggccatcggagcacgggactggacggaagaatggatcagcgagggt
tttgccacttatttagaggatgtattctggagccatgttcagaagttgggttgtagagag
gctgaagagcagagacggttaaaagctctgctgcgctggaggagactgagtgatgagtta
cagaactctgaagaagagctgcaggtcctccggcctaataaagagaacacaggggaagta
agcgagtctggtgcatcagtagtgaaacatgccctcaacccagaaaaacccttcatgcag
gtgcactatctgaagggctacttcctcctgaagtttctggctgatcaggttggcgaagag
aagttcctggacttcttcaaagtgtttgtgggaaaattccatgggcagctcattctgtct
caggatttcctgcagacactcttggacacatttccaggaatgagcaggtataatggaatg
gtattaacactggctgtccaaaacacatgctctttagtagctcactga

DBGET integrated database retrieval system