KEGG   Cyprinus carpio (common carp): 109049739Help
Entry
109049739         CDS       T05134                                 

Definition
(RefSeq) cAMP-responsive element modulator-like isoform X1
  KO
K09052  cAMP response element modulator
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109049739
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109049739
Transcription factors [BR:ccar03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109049739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 109049739
NCBI-ProteinID: XP_018922943
Position
48
AA seq 222 aa AA seqDB search
MDAGDASQPMTRSAEYEQSPLVFCKEENTKGVLPDSSTSTRLGDSPNNEDAKQKLDVETS
ARNIFNNNNAGPFISVNQGGGVQFIPCQQRYDTFTSWPGSPIMQYAVHSSNGTYIVSEDK
GQATTGGMSAYQISSPASGHSQAMDGSPGSLPSPQQLTEEASRKRELRLMKNRTAAKEYR
RRKKDYVRSLEMRIAIIENQKQKMTEELDSLRQMCTGKSNSI
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaggtgatgcaagtcaaccaatgactcggtctgcagaatatgaacagtcacca
ttagtattttgcaaagaggagaacacaaaaggggttctacctgactcttcaaccagtaca
cgtcttggtgactctccaaacaatgaagatgcaaaacagaagttggatgttgagacatcc
gcaagaaatattttcaacaataacaatgcaggccctttcatctctgtcaaccagggtggc
ggtgtccagttcatcccctgccagcagagatatgataccttcacttcctggcctgggtct
cccattatgcagtatgctgtccactccagcaatggcacttatattgtatctgaagataag
ggccaagccaccacaggaggtatgtctgcgtatcagatctcctctcctgcatctggccat
tcccaggcaatggatggctcacccggctctctgccaagccctcagcagctgactgaggaa
gcatcacgtaagagggaactccgactgatgaaaaacaggacagcggccaaagagtacaga
cgcaggaagaaggactatgtgcggagcttagagatgcgcattgccatcattgaaaaccag
aagcagaaaatgacagaagagctggacagtctaaggcaaatgtgcactggaaagtccaat
tcaatttag

DBGET integrated database retrieval system