KEGG   Cyprinus carpio (common carp): 109051144Help
Entry
109051144         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00071  Fatty acid degradation
ccar01212  Fatty acid metabolism
ccar03320  PPAR signaling pathway
ccar04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109051144
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109051144
   03320 PPAR signaling pathway
    109051144
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ccar03029]
    109051144
Enzymes [BR:ccar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     109051144
Mitochondrial biogenesis [BR:ccar03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    109051144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 109051144
NCBI-ProteinID: XP_018924245
Position
50
AA seq 781 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLHLCHEALRQIYLSGLHSWKKRFIRFKNGVMTGVYPGSPS
GLLVVLVGYMSTTKYAKIDPSLGMVTKLSKHLPISKYVTEEGQRVVGGVLIGTGLWIAVT
FVMRNVLKCLLNVLKCLLSWHGWMFNRHGSLNXKTKIWLVLVKLFSGPKPMLYSFQSSLP
RLPVPRVKDTVRRYLDSARPLMDDEQYKRMEGLAKDFEKNLGPRLQWYLKLKSWWASNYV
SDWWEEYIYLRGRGPIMVNSNYYAMDFLYVIPTTRPAARAGNSIHAIMMYRRKLDRAQIK
PLMVLNTIPLCSSQYERMFNTSRVPGVESDVLQHMNESKHIAVYHKGRFYKVWMFYDGRL
LLPREVEQQIERILADKSEPQPGEELLAALTAGDRIPWAKARSQFFSRGKNKQSLDAVEK
AAFFVTLDDSEQRYDPENPVQSLDSYGKSLLHGKCYDRWFDKSFNLIVFKNGTMGLNAEH
SWADAPIVGHLWEHVLSSDPVRLGYTEDGHCKGNSHPNLPGPQRLQWDIPEECQAVISGS
LKVAKALADDVDMHIIPFKDFGKGLIKKCKTSPDGFIQIALQLAHFRDKGKFCLTYEASM
TRLFREGRTETVRSCTSQTCDFVSAMMNDKATREEKLNLLKVAAEKHQDLYRLAMTGNGI
DRHLFCLYLVSKYLGEDSAFLKEVLSQPWRLSTSQTPLQQLDLFDLKKHPEYVTSGGGFG
PVADDGYGVSYIILGEDLINFHISSKHSSPETDSHRFGSNIRQAMLDLLDLFQLDNKANN
K
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcgcatcaggcggtggccttccagttcaccgtcactcctgatggcatcgac
ctgcacctgtgtcatgaggccctgcgccagatctacctgtctggcctccactcctggaag
aagaggttcatcaggttcaagaatggtgtcatgactggagtctatccaggaagtccctcg
gggctcctggttgttttggtgggttacatgtccaccaccaaatatgccaaaatagatcct
tccctagggatggtcactaaactgtcaaaacacctaccaatcagtaagtacgtaacagaa
gaagggcagcgtgttgttggtggtgtgctgattgggaccggattgtggattgctgtgact
ttcgtaatgagaaatgtcctcaagtgcttgctgaatgtcctcaagtgcttgctgtcctgg
catggctggatgttcaatcgccatggatctttgaacnttaaaacaaaaatttggttggtg
ctggtgaagttattttcggggccaaagccaatgctgtacagcttccagagttcactacca
cggttaccagtgcctcgtgtaaaagacacagttagaagatatcttgattcagctcgtcct
ctgatggatgatgaacagtacaaacgtatggaggggttggcaaaggattttgagaagaac
ttgggccccagactgcaatggtacctgaagctcaaatcctggtgggcctccaattatgtc
agcgactggtgggaggagtatatttacctcagaggtcgagggccaatcatggtcaacagc
aactactatgcaatggacttcctctatgtgatccccactacacgtccagctgcccgtgct
ggtaattccatccacgccatcatgatgtacagaagaaaactggacagagcacagatcaaa
ccactcatggtgttaaacacaatcccattgtgctcatctcagtacgagcgtatgttcaac
accagtcgagtacccggtgtagaatcagacgtccttcagcacatgaacgagagcaaacac
atcgccgtgtatcataagggacgcttttacaaagtgtggatgttttatgacggacggctg
ctgttgcctcgagaagttgagcagcagatcgaaaggatcttagccgacaagtctgaacct
cagccaggagaggagctgctggccgccttaacagcgggcgacagaattccctgggccaaa
gcccgctcacagttcttcagtcgagggaagaacaagcagtctctggatgccgtggagaag
gcggctttctttgttactctggatgacagcgaacagcgttacgatccagagaatccagtg
cagtcgctggacagctacggcaaatctctgctccacggaaaatgctacgacaggtggttt
gacaagtctttcaatctgattgtgttcaagaacggcactatgggattgaatgcagaacac
tcctgggccgatgcgcccatcgttggccatttgtgggagcatgtcttgtcatcagatcca
gtgagactgggctatactgaggacggacactgcaaaggaaactcccatcccaacctgccg
ggaccccagagactgcagtgggacatcccagaggagtgccaggcagtgatcagcggctct
ctgaaagtggctaaagctctggcggacgatgttgacatgcacatcatcccctttaaggac
tttggcaaaggcctgatcaagaaatgcaagacgagtcccgacggcttcattcagatcgcc
ctccagctggcgcacttcagggataaaggcaagttctgcctgacgtacgaagcctccatg
acgcgtctgtttagagagggccgcactgagaccgtacgctcctgcaccagtcaaacctgt
gattttgtcagtgccatgatgaatgacaaagcaacgagagaagagaagttgaacctgttg
aaggtggcggcagaaaagcaccaggatttataccgactggccatgacgggaaatggcatc
gaccgccatcttttctgcctctacctggtgtcaaagtacctcggggaagattcggctttc
ctcaaagaggtgttgtcccagccctggagattgtccaccagtcagactcctctccagcag
ctcgatctgtttgatttaaagaagcatccagaatacgtcaccagcggaggtggttttgga
cctgttgctgatgatggttatggtgtatcatatattattcttggagaagatctcatcaac
ttccacatatccagcaaacactccagccctgagaccgactctcaccgctttggaagcaac
attagacaggcaatgcttgatctcctggatcttttccagcttgacaacaaagctaacaac
aagtga

DBGET integrated database retrieval system