KEGG   Cyprinus carpio (common carp): 109051194Help
Entry
109051194         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccar02000]
    109051194
   04147 Exosome [BR:ccar04147]
    109051194
   04090 CD molecules [BR:ccar04090]
    109051194
Transporters [BR:ccar02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   109051194
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109051194
CD molecules [BR:ccar04090]
 Proteins
  109051194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto Pox_LP_H2
Motif
Other DBs
NCBI-GeneID: 109051194
NCBI-ProteinID: XP_018924301
Position
5
AA seq 891 aa AA seqDB search
MVHKIWTPAEHKGSYDLERMRQQEEEQHQTFTFSRDVEAARNTNTNAIKRGDAEAYVELN
ELRGEVWQEMGRWLGYEENLSPATGQWSQSHISYLTFKSLFQLRKVMSTGAVLLDVDESS
LSSICQMMVEQLLLKKEIQPTDRDALVAILQRKRSQLEPTSATGSADIELQTFSITKQRD
IVDRVEASVVLSGVVENLQKPVIAFARLRDSVVMEGVLEAPIPVXFVFFLVGPSHSGMDY
HESGRAMASLMADWVFTLEAYLATNEKDLTNAMADFMDCSIVIPPTEIQDESMLKPIINF
QKKMLRERVRPYDTRLMVGGKAPTGPEKPRDDPLARTGYPFGGMVKDIKRRYKHYLSDFT
DALDPQVLSAVIFIYFAALSPAITFGGLLADKTEHMMGVSELMVATCVQGVIFSLFAAQP
VLVIGFTGPLMVFEEAFFQFCKSNGFEYIVGRVWVGMWLIVIVVVIVAVEGSFLVRFISR
FTQEIFSILISLIFIYETFAKLIRIFKAHPLILNYEHLNASSEDPFHPIKKTNITYHPDG
NVTEHHEIIERAYPNTALLSMCLMFGCFFIALYLRGFKTSTFLPGPIRRMIGDFGVPIAI
FFMIAVDISISDAYTQKLVVPKGLTVSNTSARGWIISPFGEKKPFPVWMMFACAVPALLV
FILVPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLLVFLGGVASIFGVPWLS
AATVRSVTHANALTVMTKGPRPQIQRVLEQRVSGILVAVMVGVSILMEPILKMIPMTALF
GIFLYMGITSLSGIQLWDRILLLITPKKHHPPVPFVTRVPTMRMHLYTLIQVICLVILWA
VKSSTFSLALPFVLILTIPLRMFMTGHVFTIMEMKCLDADDANVKFDDEDD
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggtgcataagatatggacgcctgcagaacacaaaggcagctatgacttagagcggatg
aggcagcaggaagaggagcagcatcagaccttcaccttctctagagacgtagaggctgcc
cgaaataccaacaccaatgccatcaagagaggagatgcagaggcatacgttgagttaaat
gagcttcgtggggaggtgtggcaggaaatgggacgctggctgggttatgaggagaactta
agccctgccacaggacaatggagtcagtcccacatttcctatctgaccttcaaaagcctc
tttcaactccgcaaggtcatgagcacaggtgcggtgctgctagatgttgatgagagcagc
ttatcgagcatttgtcagatgatggtggaacagcttctgctcaaaaaagagatccagccc
actgaccgtgacgctcttgtagccatactgcaacgcaagcgcagtcaattagagcccact
tcagccactggttcagcagacatagagctgcaaacattctcaatcaccaaacagcgagac
atagttgatcgtgtggaggcctctgtggttttatcaggtgtggtggagaacctccagaaa
ccagtgatagcatttgcacgtctacgggattcagtggtgatggaaggggttctggaagct
ccaattccagtcncgtttgttttcttcctcgtgggccccagtcacagtggcatggactat
catgagagtggccgggccatggcgtcgctgatggctgactgggttttcactctggaggct
tacttagctacaaacgagaaggatctgaccaatgccatggcagacttcatggactgcagc
attgtgatcccacccacagaaatccaggatgagagcatgctgaagccaatcattaacttt
cagaagaagatgctacgtgagagagtccgcccatatgacacccgactcatggttgggggc
aaagccccaactggacctgagaagccacgggacgatccactggcccgcaccggctatccg
tttggcggtatggttaaagacataaaacgccgctacaagcattaccttagtgattttaca
gatgcactggaccctcaggtgctgtctgctgtcatcttcatctacttcgctgccctttct
cctgccattacatttggaggacttcttgcggacaaaacagagcacatgatgggggtctct
gagctgatggtcgctacctgtgtgcagggcgtcatcttttctctgtttgcagctcaacca
gtacttgtcattgggtttaccggtccattgatggtgtttgaggaggcattctttcagttc
tgcaagtctaatggctttgagtacatcgtgggccgtgtctgggtgggcatgtggttgatc
gtcattgtggtggtgattgtggcagtggaggggagcttccttgtccgtttcatctcacgc
ttcacccaagagatcttctccatcttgatctctctcattttcatctatgagacctttgcc
aagcttatcaggattttcaaagcgcatcctttgattttgaactacgaacacctgaatgct
tcttcggaagaccccttccaccctatcaaaaagaccaacatcacatatcatcctgatggc
aatgttactgaacatcatgagataatagagagggcctatcccaacactgccctgctgtcc
atgtgccttatgtttggctgtttcttcattgcattgtatctccgtgggtttaaaactagc
accttccttcccggccctatccgtcgaatgattggagattttggtgtccccatcgccatc
ttcttcatgattgctgtggacatcagcatcagcgatgcctacacacagaaactggtggtg
ccaaaggggctgaccgtgtccaacacatctgctagaggctggatcatcagcccatttggt
gagaagaagccattccctgtctggatgatgttcgcctgtgctgttcctgccttgttggtc
ttcatccttgttcctgccttgttggtcttcatccttattttccttgagtcccagatcact
acgctgatcgtgagtaagccagagagaaaaatggtcaagggctctggtttccatctggac
ctcctccttttggtgttcttgggaggagttgcctctatctttggtgtcccctggctcagt
gccgccacagtgagatctgtcacacatgccaacgccctgactgtcatgaccaaaggcccc
agacctcagattcaacgcgtgttagaacaaagagtcagtggtattttggtggccgtgatg
gtaggggtctcgattctcatggagcccatcctgaagatgattcctatgacagctctgttt
gggatctttctctatatgggtatcacttcactgagtggcatccagctttgggaccgtatt
cttctgcttattacaccgaaaaagcatcacccacctgttccatttgtcacccgtgtgcct
actatgcgtatgcacttgtacactttgatccaagtgatatgtttagtgattctgtgggca
gtaaaatctagtacattttcacttgctctgccctttgtcctgatcctcacgatccctctg
agaatgttcatgaccggtcacgtcttcactatcatggaaatgaaatgtctggatgcagat
gatgcaaacgtgaaatttgatgatgaggatgactaa

DBGET integrated database retrieval system