KEGG   Cyprinus carpio (common carp): 109051251Help
Entry
109051251         CDS       T05134                                 

Definition
(RefSeq) rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04270  Vascular smooth muscle contraction
ccar04350  TGF-beta signaling pathway
ccar04510  Focal adhesion
ccar04530  Tight junction
ccar04810  Regulation of actin cytoskeleton
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109051251
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109051251
   04530 Tight junction
    109051251
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109051251
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109051251
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109051251
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109051251
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109051251
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109051251
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   109051251
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109051251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH Rho_Binding MDFI SCP-1 PH_9 PH_11
Motif
Other DBs
NCBI-GeneID: 109051251
NCBI-ProteinID: XP_018924350
Position
50
AA seq 220 aa AA seqDB search
MSFAVNKLAEIMNRKDMKLDQKKRGSTTDLRKKEKENRKLQLELNQEKEKFNHMAVKYQK
ELNEMQAASQCLLAFSQCVFLLFVEILTWTSLCMHFILSSESRLEGWLAIPNRANIKRYG
WKKQYVVVSSKKILFYNDEQDKEQSNPCMVLDIDKLFHVRPVTQGDVYRAEADEIPRIFQ
VSFVSFFCFFFTHQFYLIKVAKCPIMTYYSISANCMHTRS
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgcggtgaataagctggctgagatcatgaaccggaaggacatgaagttggac
cagaagaagagaggcagcaccactgacctgcgcaagaaagagaaggagaaccgcaagctg
cagctggagctcaaccaggagaaggagaagttcaaccacatggccgtcaagtaccagaag
gagctgaacgagatgcaagcggcaagtcaatgtttattagccttttcacaatgtgttttt
ctgttgtttgttgaaattctgacttggacttcattatgcatgcattttattttgtcttca
gaatcaaggcttgaaggctggctcgcgataccaaatagggctaacataaaaagatatggc
tggaaaaagcagtatgttgtggtgagcagtaaaaaaatcctcttttacaatgatgagcaa
gacaaggagcagtctaacccctgtatggtactagatatcgacaaacttttccatgtgcgt
cctgtcacgcaaggtgacgtttatcgagctgaggccgatgaaattccaagaatattccag
gtcagttttgttagttttttttgttttttttttacacaccaattctatttaataaaggtt
gcgaaatgccccataatgacatattacagtatcagtgcaaactgcatgcatacacgtagt
taa

DBGET integrated database retrieval system