KEGG   Cyprinus carpio (common carp): 109052802Help
Entry
109052802         CDS       T05134                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C-like isoform X1
  KO
K03252  translation initiation factor 3 subunit C
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109052802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ccar03012]
    109052802
Translation factors [BR:ccar03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    109052802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI DUF2779
Motif
Other DBs
NCBI-GeneID: 109052802
NCBI-ProteinID: XP_018925778
Position
Unknown
AA seq 220 aa AA seqDB search
MVCSSGPPESMREHVVAASKAMKMGDWRTCHSFIINEKMNSKVWDLFPETQCVREMLVRK
IQEESLRTYLFTYSSVYDSISMETLSEMFELDLPTVHSIISKMIINEELMASLDQPTQTV
VMHRTEPTSLQNMALQLAEKLGGLVENNERVFDLKQGVYGGYFNRDQKGGYQQKQSYQRA
PDQRGGYQQKQGYHRDQKGGYQQKQNYQRGGYRNQNQSSY
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgctcctcaggtcctccggagagcatgagggagcacgtggtggccgccagcaag
gccatgaagatgggagactggagaacctgccactccttcatcatcaacgagaagatgaac
agcaaagtgtgggatctgttcccggaaacccagtgtgtgcgggaaatgctcgtcaggaag
atccaggaggagtctctgcgcacgtacctgttcacctacagcagcgtgtacgactccatc
agtatggagactctgtcagagatgttcgagctggatctacccacagtgcacagcattatc
agcaagatgatcatcaatgaagagctcatggcgtctctggaccagccgacccagacggtg
gtgatgcacaggacggagcccacatctctgcagaacatggccctgcagctggccgagaaa
ctgggcggcctggtggagaacaacgagcgcgtcttcgacctcaaacagggtgtttacgga
ggatacttcaacagagatcagaaaggcggttaccagcagaagcagagctaccagagagct
ccagaccagaggggaggctaccagcagaagcaaggttaccatcgagatcagaaaggaggt
taccagcagaaacagaactaccagcgaggaggataccggaaccagaaccagagctcatac
tga

DBGET integrated database retrieval system