KEGG   Cyprinus carpio (common carp): 109053207
Entry
109053207         CDS       T05134                                 

Gene name
rnpepl1
Definition
(RefSeq) arginyl aminopeptidase-like 1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109053207 (rnpepl1)
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109053207 (rnpepl1)
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109053207 (rnpepl1)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N DUF2268
Other DBs
NCBI-GeneID: 109053207
NCBI-ProteinID: XP_018926180
Position
Unknown
AA seq 527 aa
MTYDGRNKLFFLIWWLDAELTCGQTRPLVFTQGHSVCNRSFFPCFDTPAVKSTYSATVRV
PEGVTVLMSASRSAYSKQDRVFQFSMEYPVPAYLVALVAGDLQHADIGPRSRVWAEPCIL
TCAVSKLGGSVERWLNVAEGLFGPYVWGRYDIVFLPPSFPIVAMENPCLTFIISSILESQ
EFLLIDVIHEIAHGWFGNAVTNATWEEMWLSEGLATYAQRRITTEAYGEAFTCLETVFRL
DALHRQMRLLGDNNPVSKLQAKFEPGVNPSSLMNLFTYEKGFCFVSYLSQLCGDIKRFDS
FLRAYIEKFRFSSVIAQDLLDFFLGFFPELKESCVAQREGLEFERWLNGCGPPLCEPDLS
AGRALTGPVQHLCDHWGVDAPDPQVISTFDLSSWSTFQTVLFLDRLLDRSPLSQEVMSLL
SSCYSALLDGMNAEVQIRWLQIVVRNSFYPDLPRVRSFLHKHTSRMYTVPLYEDLCGGVM
KCFAVEVFYQTQARLHPNLRRTLQQILFQSSALNISTAPSLLTSPPS
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgacatatgacgggcggaacaagctgttcttcctgatttggtggctggacgccgagctg
acatgtggacagacccgaccattggtcttcactcagggtcactcagtctgcaaccggtcg
ttttttccctgttttgacaccccagccgtcaaaagcacctactctgccactgtcagggta
ccagagggtgtaacagtgttgatgagtgcctcaagaagtgcatactctaaacaggacagg
gttttccagttctccatggagtaccctgtcccagcctacttggttgccctggtggcagga
gacctacagcatgcagacattgggcccaggagtcgtgtgtgggcagagccctgcatcctg
acatgtgcggtcagtaaactgggtggcagtgtggagcgctggcttaatgtggcagagggc
ctttttgggccttatgtatggggaaggtacgacatagtgttccttccaccttcattcccc
atcgttgccatggagaatccctgtcttactttcataatttcctccatactggagagtcaa
gagtttctgctgattgatgtcatccatgagattgctcacggctggtttggcaatgcggtc
accaatgctacctgggaagagatgtggctcagtgagggtctggccacttatgctcagagg
cgcattaccacagaggcctatggagaagccttcacttgtcttgagactgtgttccgtcta
gatgctcttcacagacagatgcgtcttcttggagacaacaatcctgtcagtaagctgcag
gccaaatttgagccaggtgtaaaccccagcagtctaatgaatctgttcacctatgagaaa
ggcttctgctttgtatcttacctctcacagctgtgtggtgacatcaagagatttgatagc
tttcttagggcctacattgagaagttcagattcagcagcgtaatcgctcaggatctgttg
gacttcttccttggcttcttccctgagctgaaagagagctgcgttgctcaacgagagggt
ctggaatttgagcgatggctaaatggctgtggtcctccgttatgtgaaccagatctgtca
gcgggtagagctctaacaggacctgttcagcacctgtgtgatcattggggagtggatgcc
cctgacccccaagtgatctctacatttgacctctcctcctggagcacctttcagaccgtc
ctcttcctggaccgacttctagaccgctcacctctgtctcaagaggtgatgagtcttttg
tcaagctgctactctgcattattggacggcatgaacgctgaagtccagattcgatggctg
cagattgtagtgcggaacagcttttatcctgatctgccccgagttcgcagcttcttgcat
aaacatacctcacggatgtacacagtgcctctttacgaggatctgtgcggaggggtgatg
aagtgttttgctgtggaggtattttatcaaactcaggcccgtttgcacccaaatctacgc
aggacacttcagcagatactgttccaaagcagtgccctcaacatcagcacagctccatct
ctactcacatcaccaccctcttga

DBGET integrated database retrieval system