KEGG   Cyprinus carpio (common carp): 109054164Help
Entry
109054164         CDS       T05134                                 

Definition
(RefSeq) activin receptor type-1-like
  KO
K04675  activin receptor type-1 [EC:2.7.11.30]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04060  Cytokine-cytokine receptor interaction
ccar04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109054164
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109054164
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109054164
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     109054164
Protein kinases [BR:ccar01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   109054164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Haspin_kinase FTA2 APH
Motif
Other DBs
NCBI-GeneID: 109054164
NCBI-ProteinID: XP_018927006
Position
Unknown
AA seq 504 aa AA seqDB search
MGHCSTPIIVLFLLQFLQTSAKDVSIDCMCVGSDCNEQQCTGDQCYTSVIISKDVTTFKR
GCLIGPESKRMTCSATPSASHVIECCSQHMCNANVSKETLLRLLLTKGEAAVHYRVEMLV
LFVLGPFVVLGLLSVLALLVCRRLHHGRLERLHEFDTEQGAIDGLIASNVGDSTLADLMD
HSCTSGSGSGLPFLVQRTVARQISLVECVGKGRYGEVWRGQWQGENVAVKIFSSRDEKSW
FRETEIYNTVLLRHENILGFMASDMTSRNSSTQLWLITHYHENGSLYDYLQRVAVEMADG
LHMAASVASGLVHLHTEIFGTEGKPAIAHRDLKSKNILVKKDLQCCIADLGLAVTHTQSD
NQLDVGNNPKVGTKRYMAPEVLDETIQTDCFDAYKRVDIWAFGLVLWEIARRTISNGIVE
EYKPPFYDLVPNDPSFDEMRKVVCVEQQRPFIPNRWFSDPTLSALVKLMKECWYQNPSAR
LTALRIKKTLDKIHSSLEKGKTDC
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggggcattgcagtactccaatcatcgtcctgttcctgcttcagttcttacagacatca
gctaaagatgtctccattgactgcatgtgtgtcggtagtgactgtaatgagcagcagtgc
accggagaccagtgctacacctctgttatcattagcaaagatgtgacaacgttcaaacgt
ggctgccttatcgggccggagagcaagcgcatgacctgctccgcaacgccctcggctagt
catgtcatagaatgctgctctcaacacatgtgcaatgccaatgtctccaaagagaccctt
cttcgacttctgctgacaaaaggagaggcggctgtgcattaccgtgtggagatgttggtt
ctctttgtgttggggccgtttgtggttctgggtttgctgtctgtgctggctttgctggtg
tgccgtagactccatcacgggcgtctggaaagactgcatgagtttgacactgagcagggg
gccattgacgggctcattgcatctaatgttggagacagcacactcgcggatctgatggat
cactcctgcacatcaggaagtggttcaggactgcccttcctggtgcagaggacggttgca
cggcagatcagcctggtagagtgtgtcggtaagggacggtatggggaagtgtggagaggt
cagtggcaaggagaaaatgtagccgtgaagatcttctcttccagagatgagaagtcatgg
tttagagagacagaaatatacaacactgttctactacgacatgaaaatatattaggattc
atggcttctgatatgacctcccgaaactctagcactcagctgtggctcatcacacactac
catgagaacggctcactctacgactacctgcagcgtgttgctgtggagatggcagatgga
ctgcacatggcggcgtcagtagccagcggtctggtgcacctgcacacagagatctttggc
actgagggtaaaccggccatcgctcacagagacctgaagagcaagaacatcctggtgaag
aaagatctgcagtgctgcatcgctgacctgggtctggcagtaacacacacgcagtctgac
aatcagctggatgtgggaaataatccaaaagtgggaactaagcgctacatggcaccagag
gttctagatgagaccattcagacagactgttttgatgcctataagagggtggacatctgg
gcctttgggctggtcctgtgggagatcgctcgcagaaccatcagtaacggaattgtagaa
gaatacaagccgcctttctacgacctggtgcctaatgaccccagctttgacgaaatgagg
aaagtggtttgtgtggagcaacaaaggccgtttattcccaaccgctggttttcagatcct
accctgtctgctctggtgaagctgatgaaagagtgttggtaccagaacccctcggctcga
ctcactgccctgcgcatcaaaaagactctggataaaatccacagctcactggagaagggc
aaaaccgactgctga

DBGET integrated database retrieval system