KEGG   Cyprinus carpio (common carp): 109054490Help
Entry
109054490         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109054490
   04020 Calcium signaling pathway
    109054490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccar04040]
    109054490
Ion channels [BR:ccar04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   109054490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel NINJA_B
Motif
Other DBs
NCBI-GeneID: 109054490
NCBI-ProteinID: XP_018927292
Position
6
AA seq 1546 aa AA seqDB search
MVEYSLDLQNINFSAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFF
IFGIIGVQLWAGLLRNRCYPEENFTLTSGITLPAPYYQPEEDDERPFICSLAQDNGIMSC
RDVPTRREGGRECCLDKEDALHRQALGLSAEPLVNGSASAMGLCVNWNQYYTRCHTGHTN
PHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFIFLIIIGSFFMINL
CLVVIATQFSETKQREHQLMQEQRARCLSSSTLASLAEPGDCYEELFQLVCHILRKARRR
SAALYYMLRGKAPPPGGGRGRSRGGAGSSGGGANVNGSERHQCHSTQIIESIHKLDMIGS
FFMINLCLVVIATQFSETKQREHQLMQEQRARYLSSSTLASLAEPGDCYEELFQLVCHIL
RKARRRSAALYYMLRGKAPPPGGGRGRSRGGQDRQGEELITSLYSRYQLDHSSQPLENAI
SLSVTPNPEECPQCAVALSLKEGAGSTGHSANGEEEEGALEETDRDENCLDQKGDNDSED
SPKRKRTCFGKCKDVWDEMRVKLWGIVESKYFNRGIMIAILINTISMGIEHHNQPDELTN
VLEICNIVFTSMFTLEMILKLTAFGFFKYLRNPYNIFDGIIVIIRQLAIKLVRFMPALRR
QLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLKTEAGDTVPDRKNFDSLLWA
IVTVFQILTQEDWNMVLYNGMASTSPLAALYFVALMTFGNYVLFNLLVAILVEGFQAEGD
ANRSYSDDDRSSCNLEESEKKDSLQLSDPKISTLTPNGHLDLAPAPNARGLYPSERLSFA
LGSRKSSVSSLGRASLEQTALCPGRASLYHNWGRPAQPGIWSRRSSWNSLGRSSRCLGMG
GGGSLRVRSPHSHPAEQESLLSPPPPPLHPPLLSRHFVPCRERRALSLELPELLQVPGPV
LPPLHPRQSKKSFSGGLGSVGEHQDCNGKTPSVQPQIINEVYPQVNTRKDRDDLDDELDY
SLCFRIQKMIEVYRPDWCETREDWSVFLFSPQNKFRLLCQSIIAHKLFDYVVLAFIFSNC
ITVALERPKILQGSLERLFLTVSNYIFTAIFVGEMTLKVVSMGLYLGEQAYLRSSWNILD
GFLVFVSLIDIVVSMAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLVVETLITSLKPI
GNIVLICCAFFIIFGILGVQLFKGKFYHCLGLDVKNITNKSDCLLANYKWVHHKYNFDNL
GQALMSLFVLASKDGWVNIMYHGLDAVAVDQQPITNNNPWMLLYFISFLLIVSFFVLNMF
VGVVVENFHKCRQHQEVEEAKRREEKRLRRMEKKRRKAQKLPYYASYSHVRLMIHTLCTS
HYLDIFITFIICVNVVTMSLEHYSQPRSLEIALKYCNYFFTSTFVLEAVLKLIAFGFRRF
FKDRWNQLDLAIVLLSVMGITLEEIEISAALPINPTIIRIMRVLRIARVLKLLKMATGMR
ALLDTVVQALPQVGNLGLLFMLLFFIYAALGWELFGELGFDFDFIE
NT seq 4641 nt NT seq  +upstreamnt  +downstreamnt
atggttgaatactcccttgatctccagaacatcaacttctccgccatcagaacagtgcgt
gtactcagacctctcaaagccatcaacagagtacccagtatgcgtatcctggtgaacctg
ctgctggacactctgcccatgctgggaaatgtgcttctgctctgtttctttgtcttcttc
atttttggcatcattggcgtgcagctgtgggctggactattaagaaatcgctgttaccca
gaggagaacttcaccctcacatctggcatcaccctccccgccccatattatcagcctgag
gaggatgacgagcggcccttcatctgctcgctggctcaggataacggcataatgtcctgc
agggatgtgcccactagaagagaaggcggacgggaatgctgtctagataaagaggatgcg
ctgcaccgtcaggctctgggcctgagcgcggagccactggtcaacggcagtgcctccgca
atgggactctgtgtgaactggaaccagtactacacccgctgtcatacaggacacaccaac
ccacataaaggagcgatcaattttgacaacataggttatgcatggatcgtcatatttcag
gtgatcacgctggagggctgggtggagatcatgtactacgtcatggatgctcattccttc
tacaacttcatctacttcatattcctcatcatcattggatctttcttcatgattaatctg
tgcctggtggtcattgccactcagttttcggagaccaaacagcgagagcaccagctgatg
caagagcaacgtgctcgctgcctgtcctccagcacactggcttcactcgctgagcctgga
gattgttatgaggagctcttccagctggtctgccacatcctgcgcaaggcccgccgccgc
tcagccgccctttactacatgctccgtggcaaagcccctccccctggaggagggaggggg
cgtagcaggggaggggcaggatcgtcagggggaggagctaatgtgaatggcagcgaaaga
caccaatgccattctactcagatcattgaatccattcataaattagacatgattggatct
ttcttcatgattaatctgtgcctggtggtcattgccactcagttttcggagaccaaacag
cgagagcaccagctgatgcaagagcaacgtgctcgctacctgtcctccagcacgctggct
tcgctcgctgagcccggagactgttacgaggagctcttccagctggtctgccacatcctg
cgcaaggcccgccgccgctcagccgccctttactacatgctccgtggcaaagcccctccc
cctggaggagggagggggcgtagcaggggagggcaggatcgtcagggggaggagctaatc
acctcactgtattcacgataccagttggaccacagctcccaacctctggagaacgccatc
tcgctctccgtcaccccaaacccagaggagtgtccacagtgtgctgtcgccctgtcactc
aaggagggggcgggatcgacgggccactcagccaatggggaggaagaggagggtgcactg
gaggagaccgacagggatgagaactgcttggaccagaagggggacaatgactctgaagac
tcgccaaagaggaaacgcacctgttttgggaaatgtaaagatgtttgggatgaaatgaga
gtgaagctttggggtatagttgaaagcaagtacttcaacagagggattatgatcgccatc
ctcatcaatacaatcagcatgggcatcgaacaccataaccagcctgatgaactgactaat
gtcctggagatttgtaacatagtgtttaccagtatgttcaccctggagatgatcctcaag
ctgactgcctttggcttctttaaatatctgagaaatccctacaacatctttgatggcatc
attgtgatcatcaggcaattggccataaagctggtgcggttcatgccagctctgcgcaga
cagctggtggtcctgatgaagaccatggacaacgtggccaccttctgcatgttactaatg
ctctttatcttcatattcagtattctgggaatgcacatatttggctgcaagttcagcctg
aagacagaggctggggacacagtacctgacaggaaaaactttgactccctgctttgggcc
attgtcacagtgtttcagatcctaactcaagaggactggaacatggttttgtataacggc
atggcctctacctcccccctggctgccctgtatttcgtcgctctcatgacttttgggaac
tatgttctgttcaatctgcttgtggctatcttagtggaaggatttcaggctgagggtgat
gctaaccgttcctactctgacgatgacagatcctcttgtaatttagaagaatctgagaaa
aaggactcactccagctgtcagatcccaagatttccactttgacccctaatgggcatctg
gatttggcacctgcacccaacgccaggggcctgtacccgtctgaaaggctgagctttgcc
ctgggttcccgcaagagcagcgtgagctctctgggcagggctagcctggagcagacggcg
ctgtgtccaggacgagcctctctgtaccacaactggggacggcccgcgcagccaggaata
tggagtcgcaggtcgagctggaacagcttgggtcgatcctctagatgcctggggatgggg
ggcggaggcagtttaagggtccgtagccctcactctcaccccgctgagcaggagtccctg
ctgtctcctcctccccctcctctgcatccgcctctgctctccagacacttcgtcccgtgc
agagaacggcgggctctctctctggagcttcctgagctgctgcaggtgcctggaccggtc
ttgcctcctctgcacccccggcaaagcaagaagagcttctctgggggtctaggaagcgtt
ggagagcaccaggactgtaatgggaagacaccgtcagtccaaccacaaatcatcaatgaa
gtctaccctcaggtcaatacacgcaaggacagggatgatctggacgatgagctggactat
agtctatgtttccggatccagaagatgatcgaggtgtacagaccagactggtgtgagacc
agggaagactggtccgtcttcctcttctctccccaaaacaagttcaggttgttgtgccag
tccattattgcccataagctgtttgactatgtggtgctggccttcatcttctcaaactgc
atcactgtggctctggagagacccaagatccttcagggtagcctggagaggcttttcctc
accgtgtccaattacattttcacagccatatttgtgggggagatgacactcaaggtggtg
tctatgggattgtatcttggagagcaggcatacttgcgcagcagttggaacattttggat
ggtttcctggtgtttgtgtctttgattgacattgtcgtgtcgatggcgggtggggctaag
atcctgggggtgctcagagttctcaggcttctacgcacactgcgccccctcagggttatc
agtcgagctcctggcctcaaactggttgtggagactttgatcacctctctgaagcctata
ggaaacatagttctcatctgctgtgcctttttcatcatctttggcatcctgggagtccag
cttttcaaaggcaagttctaccactgcttgggcctggatgtcaaaaacatcaccaacaag
tctgactgcctcttggccaattataagtgggtccatcacaagtacaactttgacaacttg
gggcaggctctgatgtccctgtttgtgctggcatcgaaggacggctgggtcaacatcatg
tatcatggtttggacgcagtggcggtggaccagcagcccataaccaataacaacccctgg
atgctactgtacttcatttcctttctcctgatcgtcagtttcttcgtactgaacatgttt
gttggagtggtggtggagaacttccacaagtgccgacagcaccaggaggtggaggaggcc
aagaggagagaggagaagcgactgagacgcatggagaaaaagagacggaaggcccagaag
ttgccctactatgccagttacagtcacgtgcgactgatgatccacaccctgtgcaccagt
cactacctggacatcttcatcaccttcatcatttgtgtaaacgttgtgactatgtcactg
gagcactacagccagcctcgttctctggagatcgcactcaagtactgtaattatttcttc
accagcacctttgtgctggaggctgtcctgaagctcattgcgtttggcttccgacgtttc
ttcaaagacaggtggaaccagctggatttggctatagtgctgctgtcagtcatgggcatc
acgttggaggagatcgagatcagtgctgctctgcctatcaaccccaccatcatacgcatc
atgagggtcctgcgcatcgcacgtgtgctaaagctgttaaagatggccacgggaatgaga
gcattgctggatacggtggttcaagccctgccacaggtggggaaccttggcctcctcttc
atgttgctgttcttcatttatgctgcactggggtgggaattgtttggagagctgggcttt
gacttcgacttcattgagtaa

DBGET integrated database retrieval system