KEGG   Cyprinus carpio (common carp): 109055219Help
Entry
109055219         CDS       T05134                                 

Definition
(RefSeq) vam6/Vps39-like protein
  KO
K20183  Vam6/Vps39-like protein vacuolar protein sorting-associated protein 39
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109055219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109055219
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    109055219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Vps39_2 Vps39_1 CNH Clathrin WD40_like
Motif
Other DBs
NCBI-GeneID: 109055219
NCBI-ProteinID: XP_018928002
Position
Unknown
AA seq 824 aa AA seqDB search
MHDAYEPVPILEKLPLQIDCLAAWDDWLLVGTKPGHLLLYGIKKDAGTNRFEVTLEKSNK
NFSKKIQQLFVVSQYKILVSLLENNIHVHDLLTFQQITVISKARGATLFACDLQQSSSGE
AKLRMCVAVKRKIQLYYWKDRDFHELQGDFTAPDVPKSMAWCENSICVGFKRDYYLIRMD
GRGSVKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGVCTQWVCMMSSVFTCLSL
EHQPPYIIAVLPRYVEIRTLEPRLLVQSIELQRPRFITSAGSNVVYVASNHFVWRLVPIS
IASQIRQLLQDKQFELALQLAKMKDDSDADKRQQIHHIQNLFAFNLFCQKRFDDSMQVFS
KLGTGEFIQHDADKRQQIHHIQNLNNIKNSNVSKLLVCTVYLFFYPQTNVALVSPLLRLE
NNHCHIEESEYVLKKAHKYSELIILYEKKGLHQKALQVLLDQSTKANSPLKGHERTVQYL
QRLGVENLDIIFEFSPWVLKICSEDGLKIFTEDLTEVETLPRDKVLNFLKEGFKELAIPY
LEHIIHLWDETQPEFHNVLIQLYLEKVQGLMKVYLSSLPEGVPAVAAGKEAGELGEYRNK
LLSFLEVSSSYEPEGLISDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAEEYC
HGHYDPSANGNKDVYLSLLRMYLSPPDVHFLGPIKMQLCEPQPNLQAALRVLQLHHSKLN
TTKAINLLPANTQIREIQVFLESVLEEKAGRKRFDQVLKSLLQAEFLRVQEERIFHQQVK
CVITDEKTCRVCKKKIGNSAFARYPNGVVVHYFCCKDRSVCPEE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacgcatacgagccagtccctatcctggagaaactacccctccagatcgactgt
ctggcggcatgggatgattggctccttgtggggaccaaaccgggccatctccttctgtac
gggatcaagaaagatgcaggtacaaacaggtttgaagttacattagagaaatccaataag
aacttctcaaagaagattcagcagctgtttgtggtgtcacagtacaagattttggttagt
ttgttggaaaataacatccacgttcacgacctgctcacgttccagcagataactgttata
tccaaagccagaggagccactctgtttgcctgtgacctgcagcagtccagctcaggcgag
gccaaactgcgcatgtgtgttgcagtcaagaggaaaattcagctgtattactggaaggac
agagatttccatgaattacagggggatttcaccgctccagacgttcccaagtccatggct
tggtgtgagaactccatatgtgtgggtttcaagcgagactactatctgatccggatggac
ggacgtggctcagtcaaggaactcttccccacagggaaacagctggaaccactggtggcc
ccgctggctgatgggaaggtcgcggtgggtcaggatgacctcacggttgttttgaacgaa
gaaggcgtctgcactcaatgggtatgtatgatgtcatctgttttcacatgtctttcatta
gagcaccagccaccgtacatcatcgcagtgctgccacgctatgtggagatccgcaccctt
gagcccagactgctggtgcagagcatagagctgcagagaccgcgcttcatcacctccgct
ggatcaaatgttgtgtacgtcgcgagcaatcacttcgtttggcgtctggtgcccatctct
atagccagccagatacgacagctgctacaggacaagcagtttgaactggcgcttcagcta
gcaaaaatgaaggatgattcagatgcagacaagagacaacagatccatcacattcagaac
ctgtttgccttcaacttgttctgtcagaagcgctttgacgactccatgcaggtgttttct
aagttaggcacaggtgagttcatacagcacgatgcagacaagagacaacagatccatcac
attcagaacctaaataacattaaaaatagtaatgtttccaaacttttggtctgtactgta
tatctttttttttatccacagaccaatgtagccttagtgtcgcctctcctgcggctagag
aacaaccactgtcacatcgaggagagcgagtacgtgctgaagaaagcccacaaatacagc
gaactcatcatcctctatgagaaaaaaggccttcatcagaaagctctgcaggttctgctg
gatcagtccaccaaagccaactctcctctgaaggggcatgagaggactgtacagtatctt
cagagactcggtgtggagaacctggacatcatttttgagttttcgccgtgggttctgaag
atttgttcagaagatggactgaagatcttcaccgaggacctgacggaggtggagactctg
cccagggataaggtgttgaacttcctgaaggagggcttcaaggagctggccatcccgtac
ctggagcacatcattcacctgtgggacgagacacagcctgagttccacaatgttctgatc
cagctctacctggagaaggtgcaaggcctcatgaaagtgtacctcagctcactgcctgaa
ggtgttccagctgtggctgcaggaaaggaggcgggagagctgggagagtacaggaacaag
cttctgtcgtttctggaagtgtccagcagctatgagccggagggactcatcagtgatttc
ccgtttgatggtctgttggaggagagggctcttcttctgggtcgtatggggaaacatgag
caggctcttttcatctatgtacacattctcaaagacacgcgtatggctgaagagtactgc
cacggtcattatgatccatcagcaaatggcaataaagatgtgtatctgtccctgctgcgc
atgtatctgtctcctccggacgtgcacttcctcgggcccataaagatgcagttatgtgag
ccacagccgaacctccaggccgccctgagagttcttcagctccaccacagcaagctgaac
accaccaaagccataaacctgctgccagccaacacacagatccgagagatccaggtgttt
ctggagagtgtgctggaggagaaggctgggaggaagcgctttgaccaggtcctgaagagc
ctgctacaggccgagttcctgcgggtgcaggaggagcgtatctttcaccagcaggtgaag
tgtgtcatcacagatgagaaaacctgcagagtgtgcaagaagaagattggaaacagtgcc
tttgccaggtatcctaacggtgtggtggtgcactacttctgctgtaaagatcgcagcgtg
tgtccagaggagtag

DBGET integrated database retrieval system