KEGG   Cyprinus carpio (common carp): 109055408Help
Entry
109055408         CDS       T05134                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP11-like isoform X1
  KO
K09576  FK506-binding protein 11 [EC:5.2.1.8]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccar03110]
    109055408
Enzymes [BR:ccar01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109055408
Chaperones and folding catalysts [BR:ccar03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    109055408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 109055408
NCBI-ProteinID: XP_018928174
Position
Unknown
AA seq 192 aa AA seqDB search
MRIRTGIALVFLAALTFVAAEDGDSKESVIEQLVVETLVKPETCTITSEMGDTLQIHYTG
RLLDGKVIDTSLSRDPLVVELGRRSVITGLEQALVGLCEGQKIKATIPAHLAYGKRGFPP
TIPGDSTLEFEVEVISLSQKTAWQKLVNDILPLLCLALVPTLLGLVGLYLYNKAHAQPHG
KKKSKDKKSKKK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattcggacagggatcgccttggtttttctcgcagctttaacatttgttgcggct
gaggacggagatagcaaagaaagcgtgatcgaacagttggttgtggagacattggtgaag
ccggagacatgcacgattacatccgagatgggagacacgcttcagatccattacacgggt
cgattattggacgggaaggtgattgacacctctttgtctcgtgatcctctggtcgtagag
ttgggcaggaggtctgtcatcacaggtctagaacaagccctggtcggattgtgtgaagga
caaaaaatcaaggccacgattccagctcatctcgcatatggaaagagaggattccctcca
accattccaggggacagcactcttgagtttgaggtggaggtgatctctctgtcccagaaa
acggcgtggcagaagctagttaatgacatcttgcctcttttgtgcttggcactggttccc
actttactgggtttagtgggtctctacctctacaacaaagcacatgcccaacctcacggc
aagaagaagagcaaagacaagaaaagcaagaagaaataa

DBGET integrated database retrieval system