KEGG   Cyprinus carpio (common carp): 109056934
Entry
109056934         CDS       T05134                                 

Definition
(RefSeq) arginyl aminopeptidase-like 1
  KO
K09605  arginyl aminopeptidase-like 1 [EC:3.4.11.-]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109056934
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     109056934
Peptidases and inhibitors [BR:ccar01002]
 Metallo peptidases
  Family M1
   109056934
SSDB
Motif
Pfam: Leuk-A4-hydro_C Peptidase_M1_N Peptidase_M1
Other DBs
NCBI-GeneID: 109056934
NCBI-ProteinID: XP_018929669
Position
Unknown
AA seq 554 aa
MAELQRPTLCCCRKVLTVPGNKSCEGGRSLAHCRLVDVASASNFHSFKLRHFHLDLHLNF
AVKRITGWQVLELTPVQPGVQSLILDTHPSLLVHSVDCKVPGASGAPDVVLSLTYRIEPF
TDYGSSLNISLPAAVIRPHRAFRVTIRYTTTDGPAIWWLDAELTCGQTRPLVFTQGHSVC
NRSFFPCFDTPAVKSTYSATVRVPEGVTVLMSASRSAYSKQDRVFQFSMEYPVPAYLVAL
VAGDLQHADIGPSFEVSEPCYPFSFSFSKGVNPSSLMNLFTYEKGFCFVSYLSQLCGDIE
RFDSFLRAYIEKFRFSSVIAQDLLDFFLGFFPELKESCVAQREGLEFERWLNGCGPPLCE
PDLSAGKALTGPVQHLCDLWGMDAPEPQVISTFDLSSWSTFQTVLFLDRLLDRSPLPQEV
MSLLSSCYSALLDDMNAEVQIRWLQIVVRNSFYPDLPRVRSFLHKHTSRMYTVPLYEDLC
GGVMKCFAVEVFYQTQARLHPNLRRTLQQILFQSSAFNTSTAPSLLTSPPSAPSSPTDPT
ANGTIALRDVNVSA
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggccgagctgcagcggccgacgctgtgctgctgtcggaaagtgctgaccgtgcccggt
aacaagtcctgcgagggcggccggagtctggcgcactgtcgcctggtggacgtcgcgtcg
gcgtctaacttccacagctttaaactccgacatttccacctggacctccacctgaacttc
gccgtcaagaggatcacgggatggcaggttctggagctcacgcccgtccagcccggcgtc
cagtcgctcattctggacacgcatccttcgttattagttcattccgtggactgcaaggtg
cccggcgcgtccggtgctcccgatgtggttttgtcgctcacctaccgaatagaaccgttc
accgattacggatcctccctgaacatcagcctcccggccgcggtgatccggccgcaccgg
gctttccgtgtcaccatccgctacacgaccacagacggccctgcgatttggtggctggac
gccgagctgacatgcggacagacccgtccgttggtcttcactcagggtcactcggtctgc
aaccggtcgttttttccctgttttgacacaccagccgtcaaaagcacctactctgccact
gtcagggtaccagagggagtaacagtgttgatgagtgcctcaagaagtgcatactctaaa
caggacagggttttccagttctccatggagtaccctgtcccagcctacttggttgccctg
gtggcaggagacctacagcatgcagacattgggcccagttttgaagtgtcagagccatgt
tatccattttccttctctttctccaaaggtgtaaaccccagcagtctaatgaatctgttc
acctatgagaaaggcttctgctttgtatcttacctctcacagctgtgtggcgacatcgag
agatttgatagctttcttagggcctacattgagaagttccgattcagcagcgtaatcgct
caggatctgttggacttcttccttggcttcttccctgagctgaaggagagctgcgttgct
caacgagagggtctggaatttgagcgatggctaaatggctgtggtcctccgttatgtgaa
ccagatctctcggcgggtaaagctctaacaggccctgttcagcacctgtgtgatctttgg
ggcatggatgcccctgagccccaagtgatctctacatttgacctctcctcctggagcacc
tttcagaccgtcctcttcctggaccgacttctagaccgctcacctctgcctcaagaggtg
atgagtcttttgtcaagctgctactctgcgttgttggacgacatgaacgctgaagtccag
attcgatggctgcagattgttgtgcggaacagcttttatcctgatctgccccgagttcgc
agcttcttgcataaacatacctcacggatgtacacagtgcccctttacgaggatctgtgc
ggaggggtgatgaagtgttttgctgtggaggtattttatcaaactcaggcccgtttgcac
ccaaatctacgcaggacacttcagcagatactgttccaaagcagcgccttcaacaccagc
acagctccatctctactcacatcaccaccctctgccccttcgtcgcccacagaccccact
gccaacgggaccatcgccctgcgagacgtcaatgtgtccgcatga

DBGET integrated database retrieval system